SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014431 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014431
Domain Number 1 Region: 1276-1555
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.87e-60
Family MHCK/EF2 kinase 0.0016
Further Details:      
 
Domain Number 2 Region: 76-169
Classification Level Classification E-value
Superfamily Immunoglobulin 1.57e-19
Family I set domains 0.0097
Further Details:      
 
Domain Number 3 Region: 1216-1290
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000191
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014431   Gene: ENSGACG00000010898   Transcript: ENSGACT00000014458
Sequence length 1629
Comment pep:novel group:BROADS1:groupXIX:12932396:12942731:1 gene:ENSGACG00000010898 transcript:ENSGACT00000014458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSRRPMTRSFSGNGRTSSFSEEEGSSSSGRTESRNPYLSNVRPENRLLSKQLSYAINYV
STLCSVMAQLTEDIQPSFDTTLKSRAVSENCNVKFTCVVSGYPAPELKWYKDDMELDRYC
GLPKYEICRNGKAHTLHIYKCTLDDAAIYQVSASNSKGIVSCSGVLEVGTMNEFQIHQRF
FAKLKQKAEKKKKDLEDHTKKRDKENTERPQRKRHVPAEEETVTVTSKDLDEKSPSEDTS
AKKKIKITNGVDAGVDNSSRRSSRTNMMGVGGENSYDGGMGLAQFLAETLQSQAAEENQS
SSRGEKPKEMDIPVASVSEEKVEEQERMQNMVEEQDKVLEEGQERKTDQPPAHKLPLGSV
DVSTGRSGDAAHAAEEATEESLGPDSGSPGPKPELYPAEVKESVIKEVPVHQQAPDCLVV
SPPSNQEDVRDKSSPMEEMPVPPQTQDSYKEKYSFTPTLNGLEKSWTCSNNLISWSSSLN
LGEAPNETSQEEKMSVDKTGKEGEPDTGEVSSNNELCAEEKRNSVTQTSQITEVTTCSLE
KRIEPCKSNTTGHILLLTPAVAAHNVERDESKERAECSSLIQEMNSSNTGFQSCEEESEL
KDVLISALDVEVNSGNDLKPQEQVILEAQSAGERNQSLELEVEQQEKNQVKDEQLDESKS
LSVTQNQKGDVYVLEDYNKVAHEQSSERQQGQPSAKIPQIQTSTIDDNPDIKPPVAADKQ
NEQFIIPKIEIMESELKECTLPLTILGSNKQESEPAHLEKHDANSVSTLTIQGYSVVDST
SSLPTQKSLPNDISLSLGENVKEVVQLDDATKRSEREQPRLISSEQLPQMDCAPIPVINV
SCTGNQEEDLKVNTHVSDTQLPLETPSVPFFVVPPISVTCYESDSGNTQSEWMETEASAA
TQRGTKPNVDTYNTSVPEKPQSGNHDLERKTEKGIAGNTPSVLCETPNPKVGDKVPPFSR
SIEDNIAADILTTNHLKEAKKENSVSAEDLQRNRSSVERLCSKPPAHPSLSPASLRKFMS
KTAADTEGIAAGDRQTDKAEDDLSGGSTPTSSLSCESSPRLKRRDSLSLIRSATPEELAS
GARRKIFILKTKEDGEGAVVGALETQVRKENPYMSPSQARRAALLQAPSGQNTPPMERRS
PLLNRRKVTLEVPRVVEQTPAAEPVSTKQDEKPTEKKPNPLKGRAFEEKKNEKVVHVLSL
AQVLRKIRGEPFPDASGHLKLWCQFFNVLSDSTIKWYRDEKEILEVKRRSSSGGDESQVA
LVVVLASSNDCGVYGCSIINEYGTDTTDFLLSTDILSGILLKDDLEVGEEIEMTPLLFNR
GLADCGSWAAKYFGRIMTETVHIGEGFAHKASRVKVIYGLDPIFESGSACIIKVKSPIAY
GTTQESNLAERNLQITKQECKVQNMIREYCKIFAAEARVIENFGFSLEVIAQYLMYRPAN
SVPYATVEAYSEGVFLTYCTMDPNGMLVTRNVSEVEQKCCTFQHWIHQWTHGNLLVTRLE
GVETKITNVRVVTKSKGYQGLTEQGSPEAFEQFQTHHQCNYYCGLLGLRSLKPMDNLQQP
TKMKGSRSPLLNRKLGSHSPQLQRKGNSPQVSRKANPSPKVTRKIAETEDTKSGAKPKPA
ETVEVLEMR
Download sequence
Identical sequences G3PA07
ENSGACP00000014431 69293.ENSGACP00000014431 ENSGACP00000014431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]