SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014435 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014435
Domain Number 1 Region: 115-309
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.42e-59
Family Astacin 0.0000938
Further Details:      
 
Domain Number 2 Region: 431-534
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-37
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 3 Region: 747-860
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.33e-36
Family Spermadhesin, CUB domain 0.00015
Further Details:      
 
Domain Number 4 Region: 316-425
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-35
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 5 Region: 576-708
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-33
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 6 Region: 885-978
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-29
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 7 Region: 701-744
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000128
Family EGF-type module 0.008
Further Details:      
 
Domain Number 8 Region: 536-579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000643
Family EGF-type module 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014435   Gene: ENSGACG00000010897   Transcript: ENSGACT00000014461
Sequence length 989
Comment pep:novel group:BROADS1:groupXIII:12056151:12080196:-1 gene:ENSGACG00000010897 transcript:ENSGACT00000014461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLTARCLCLLLFLGVVFAIDLEAIDPGYYVESGATSEPIDYKDPCKAAAFLGDIALDEE
DLRFFKVDRIIDLAQRTVQIVNHTGNNYLKSEGSTNQSSQNSRGSLRNKRAATSRPERVW
PEGVIPYVISGNFSGSQRAIFRQAMRHWEKHTCVTFVERTQEESYIVFTYRPCGCCSYVG
RRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDEHVSIIRDNIQPGQEYNFL
KMEPGEVDSLGEVYDFDSIMHYARNTFSRGIFLDTILPRYDVNGVRPPIGQRTRLSKGDI
TQARKLYKCSRCGDSLQDSSGNFSSPGFPNGYSAYMHCIWRISVTPGEKIILNFTSMDLY
RSHLCWYDHVEIRDGYWRKAPLKGRFCGDKLPEPIVSTDSRLWIEFRSSSNWVGKGFSAV
YEAICGGEVKKDSGQIQSPNYPDDYRPNKMCIWKITVAQGFHVGLTFQSFEIERHDSCAY
DYLEVRDGNSESSPLLGRFCGYDKPDDIKTSSNQLWMKFVSDGSVNKAGFAANFFKEMDE
CSKPDNGRCEQRCVNTLGSYKCACDPGYELAADKRSCEAACGGFITKLNGSITSPGWPRE
YPPNKNCIWQLVAPTQYRITLLFDVFETEGNDVSTVVILKRHGVCKYDYVEVRSGLSADS
RLHGKFCGAEKPEAITSQYNNMRIEFKSDNTVSKKGFKAQFFSDKDECSKENGGCQHECV
NTFGSYSCQCRSGFVLHDNKHDCKEAGCDHTVNSVNGVITSPNWPDKYPSKKACTWALTT
TPGHRIKIAFNELDMEAHLECAYDHIEIYDGRDGKAPSLGRFCGTKKPQPITSSASKLFV
RFFSDNSVQKKGFEASHSAVTECGGRLKAEVKTKDLFSHAQFGDNNYPGASDCQWVISAE
KGYGVELIFQTFEIEEEADCGYDYMELFDGADTKSPRLGRYCGSGPPEEIYSAGDSIVIK
FRSDDTINKKGFHVRYTSTKFQDTLHSRK
Download sequence
Identical sequences G3PA11
69293.ENSGACP00000014435 ENSGACP00000014435 ENSGACP00000014435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]