SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014573 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014573
Domain Number 1 Region: 35-133
Classification Level Classification E-value
Superfamily SH2 domain 5.12e-23
Family SH2 domain 0.00052
Further Details:      
 
Domain Number 2 Region: 156-204
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000209
Family SOCS box-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014573   Gene: ENSGACG00000011015   Transcript: ENSGACT00000014599
Sequence length 205
Comment pep:novel group:BROADS1:groupXI:9066121:9067557:-1 gene:ENSGACG00000011015 transcript:ENSGACT00000014599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTLSKFDSAMSSSLLDSSMRFPQRYKTFASKAQYQMVLATLHKLQESGFYWAAITGKDA
NAMLADETIGTFLVRDSSDNRHLFALSVKTASGTKNLRIQCDASSFYLQTDPKNIHSVPH
FDCVLKLVHFYMPQSKVNSRGGNMYFIYSGGEKIPLELVKPLSDSLSTLQHLCRKTVNGH
LDISAKRDQLPHPLREFLQDYDAPI
Download sequence
Identical sequences B1NJH0
69293.ENSGACP00000014573 ENSGACP00000014573 ENSGACP00000014573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]