SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014616 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014616
Domain Number 1 Region: 610-815
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-40
Family Laminin G-like module 0.00088
Further Details:      
 
Domain Number 2 Region: 368-556
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-35
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 865-1081
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-34
Family Laminin G-like module 0.0006
Further Details:      
 
Domain Number 4 Region: 279-371
Classification Level Classification E-value
Superfamily Immunoglobulin 3.24e-20
Family I set domains 0.011
Further Details:      
 
Domain Number 5 Region: 196-288
Classification Level Classification E-value
Superfamily Immunoglobulin 1.14e-19
Family I set domains 0.0071
Further Details:      
 
Domain Number 6 Region: 5-96
Classification Level Classification E-value
Superfamily Immunoglobulin 3.37e-17
Family I set domains 0.011
Further Details:      
 
Domain Number 7 Region: 116-197
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000322
Family I set domains 0.025
Further Details:      
 
Domain Number 8 Region: 808-851
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000107
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 9 Region: 545-586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000896
Family EGF-type module 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014616   Gene: ENSGACG00000011047   Transcript: ENSGACT00000014642
Sequence length 1104
Comment pep:novel group:BROADS1:groupXII:14355095:14365672:-1 gene:ENSGACG00000011047 transcript:ENSGACT00000014642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVTVMLDVETPPYATSMPDDVAVRVGEVIRLQCLAHGTPPLTYTWTKLDGNLPPRAQVSG
GDLQINLASAEDAGSYKCVASNKVANSEVIAKVTVRCKFTENSFPSAAPLAVRVSPQVEV
KAQGSAVEFTCSSAGGIETKIEWLKEGGALPPNHHIKDGVLRIENLEQSNEGVYICRASS
VYGQAQDAARLTIQALPKVMINVRTSVQTVMIGNSVEFECQAVGDPEPTVRWSKVGGSLP
AHIMVKGGMLRIEKVTEADAGKYRCTATNNVGSVQSQVVLNVQSLPQIATLPETKEVTVG
SDAVLPCVASGYPAPEIKWSKVEKELPPKCFQEHNVLTVPRVTHDDSGIYVCTASNKQGK
VEAFTTLQVHERVMPYFAQEPLSYLTLPTIKNAYKAFSIKINFRPDNVDGMLLYNGQKKT
TGADFISLGLVGGRVEFRFDVGSGMATIRDPNPVKMGEFHTVELYRNHTLGYITVDGREP
INGTSQGKFQGLDLNEEVHVGGYPNYTVLAKTAGINTGFVGCIRQLVIQGEEVIFKDLDR
SSTGVTNCPTCKDHPCQNGGVCEDSDASLYMCGCPRGFTGSNCQHHSSLHCHPEACGPDA
TCIPRTSSLGYECRCHLGKFGNKCMDGELVTTPLFGEESYIAYPPLTNVHDDLRVELEFK
PMERDGLMFFCGGKKMKVEDFVAISMVEGHVEFRYELGTGQAILLSPEPVSLGQWHSVVA
ERNKRVGHLKVDQGPVEKKTSPGKAQGLNIHTHMYLGGVPDMDILPKPANISELFEGCIG
EVSINNKQVDLSYSFTDSRSIRKCVDNSPCDRRPCLNGGDCLSSFEYEYQCLCKDGFEGE
RCEVVRDACQSNLQCQNGGSCVKGQCVCAPGRTGLNCEEISSLYNHPSGSLHPSATGGHC
SNSPYQYAAHFHDDGYIALPKSVFPRSVSAHDSPETIELEINTSSSEGLILWQGVERGEH
GKGKDFVSLGLQNGHLVFSYQLGSGEAEILSQKAINDGRWHKVTAVRTGKNGYIQIDGGV
ELSGQSKGRSLMVNTKGSIYLGGPPATGGAPDMAAMTGGKFSSGMTGCVRNLAMMNARPG
QQPAQAIDLQTHAAHGINVLPCSS
Download sequence
Identical sequences G3PAJ2
ENSGACP00000014616 69293.ENSGACP00000014616 ENSGACP00000014616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]