SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014780 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014780
Domain Number 1 Region: 853-996
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-16
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 2 Region: 956-1090
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000471
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 3 Region: 567-609
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000175
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 4 Region: 760-879
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000188
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 724-767
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000533
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000014780
Domain Number - Region: 648-685
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000117
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 107-159
Classification Level Classification E-value
Superfamily FnI-like domain 0.000377
Family VWC domain 0.015
Further Details:      
 
Domain Number - Region: 415-519,567-610
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0361
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014780   Gene: ENSGACG00000011170   Transcript: ENSGACT00000014808
Sequence length 1195
Comment pep:novel group:BROADS1:groupXVII:11892047:11921498:1 gene:ENSGACG00000011170 transcript:ENSGACT00000014808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVSLSQPDCTGADCPQLDNCIEEVLEPAGCCVSCLQRGCTCEGYQYYDCVNAGFKNGKVA
EGDSYFVDYGSTECSCPLGGGRISCYYNSCPDMPPNCIDASEPVNGCAQCERVGCVHGEQ
KYDAGHSFHVDPCRVCHCPSKGGKVMCYPVPDCDPHQDDPEEYDYGATAFPDPYLQSLVF
PTQSSPSEKVISVSRGSERPDQTSALQSFERHKSSNLASLYPEAAPEPSTSPPRRPEYPT
TPASLRVTASQPPAGVEDTGQIRYIEPLPANSKGGSNSESLPTKAFIRGTFKTCKRRGTS
ASGPQLRLNPDRSWTRVIMQDARGTETMNGLAAVSASVVTTSKASTPRRHRRPLASRRAP
SAELTPSPRNPPVWATTPIQLFPRFPKEAPVNSNGYHSWPTGPGASVEEQLQSCCAAGQK
WASEKHHCDHMTPLDQDVCSVAWKQCCLSSVKERRCASGMASARGGDTCAVEKEHQCTDD
SHQVCCSCCALGLRLRRRGRGCDAHQHLGFPCGHVFLACCESQIPLRRKLKPGPTSTPSK
VSDGKFPNEAFSIGAADERANAVGDPEDVDECRLLAGQLCQHTCTNVWGSYRCGCDRGYV
LQRDGHSCAPGAVSPDEDNGVPEYGPAAVPTQGALAGGTTPGLDPCAENGPCGQRCAVAA
GRARCSCFPGFSLKTDGHTCEAKDKSVCSLSDLQCTEFCTETIYFLFCSQPGEMCGEAVM
HNLNSKCVYMDECATGAHGCRPGEHCVNTVGSFACEQRVACPAGYRRRNGVCEDADECAL
RTHNCGTGFACQNTAGSFLCKPRHKCISGFTQDSHGNCVDVDECSSLSEPCSSGFNCVNT
VGSYTCQQKVIMCSHGHHVGPDGARCVDIDECQVGTHRCGGGQICHNLPGSYRCDCQTGY
QYDALRKACTDVNECWRHTGRLCAQTCENTPGSYRCSCAAGFSLAADGKNCEDVNECDHS
PCSQECANIQSSYQCYCRQGYFLKEDGHTCEDIDECSQSIGNLCTFKCVNVAGSYQCACP
PRGYVMSANGRTCKDLDECSAGTHNCSLGQNCYNLQGGFRCLSLDCPPNYKKVSDTRCER
TSCPSSSLDCQKAPVRITHYQLSFQTNIITPAQIFRIGPSPAYAGDHVVISVVKGNKEGY
FGTRKLNGFTGAVYLQRQVRQPKDFLIDVEMKLLRQGTVTSFLARIYVFITSSTM
Download sequence
Identical sequences G3PB06
ENSGACP00000014780 ENSGACP00000014780 69293.ENSGACP00000014780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]