SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014917 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014917
Domain Number 1 Region: 6-187
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-50
Family SPRY domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014917   Gene: ENSGACG00000011287   Transcript: ENSGACT00000014945
Sequence length 204
Comment pep:novel group:BROADS1:groupVI:14531595:14532641:1 gene:ENSGACG00000011287 transcript:ENSGACT00000014945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GARWLRPGLRKYSCELTLDTNTVNRRLKLSDNNRKVTYVEEEYQLYPDHPDRFDHSSQLL
CRTGLTGRCYWEVEWRGGVYVSVSYRGIRRKGCRGECWFGRNDQSWSLRCSHEGYYVRHN
KTGTRISSSSSSSFSSFGRVAVYVDCPAGSLSFYRVSSDTLIHLHTFNTTFTEPLYPGFA
LWSWSWSGSSVSLCSVEEGESPGR
Download sequence
Identical sequences G3PBE3
ENSGACP00000014917 ENSGACP00000014917 69293.ENSGACP00000014917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]