SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014951 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014951
Domain Number 1 Region: 25-315
Classification Level Classification E-value
Superfamily L domain-like 1.28e-52
Family Ngr ectodomain-like 0.014
Further Details:      
 
Domain Number 2 Region: 412-452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000182
Family EGF-type module 0.019
Further Details:      
 
Domain Number 3 Region: 467-542
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000658
Family Fibronectin type III 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014951   Gene: ENSGACG00000011313   Transcript: ENSGACT00000014979
Sequence length 677
Comment pep:novel group:BROADS1:groupXI:9901388:9903421:-1 gene:ENSGACG00000011313 transcript:ENSGACT00000014979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTPLMPFLLFLILPDATWSSECPDDCYCTPPGSIFCFQRRSSTIPKGVAPSTESLYLFSN
GIEGLTTEDFEGMEKLEMLDLSQNKLTELADRVFEPLTSLRNLDLSSNQITHISEDCFQG
MELLERLYLSNNHIETIHPIAFIGLEHLLELKLQGNQLTSLPALSMPQLLLLDLRFNVLP
ILGPSDLQTPNLESLKLGGVGLISLNKELIRSLKNLHELDISGNKLESFPSALKETQGLI
HLNMAGNPMGPLKVQDLQNIGELQELDISSLSLQGLPEEFSQLLPHLKKLTVAENPFNCL
CTLAWFPRWLKAQSITLERTEETRCHFPPINAGKVLERLEHRDLGCPTTTTVTPSTVRTT
TTPPVPVTTFLVITRDIPILRSGNKPDKDDSPLPPALASPSSSSMDQGEEHPFCPPDTCL
NGATCHLDQHGQVECTCPHGTSGMYCEVQNHHPPSPPEAEVPMATVSVDAPDISSHQATT
TSILLDLHRYIEMRPYIRGIRLTYRNLSGPDRRPIQLNLPPKFPEYILRGLQPNSTYRVC
ASPLGAPSGTDSVCTEAHTVPESKRSPQIDDQRLTTTLVPAIAILLLLVLIAMAVGVVCY
LRRKRANGQLDLECEPSQLELDGVKAGLDNGALPQKQPQLMIPEPAVQNGNLEYEVLLLQ
DHCTSNNNMTSHKPSYF
Download sequence
Identical sequences G3PBH7
ENSGACP00000014951 69293.ENSGACP00000014951 ENSGACP00000014951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]