SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015101 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015101
Domain Number 1 Region: 17-181
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.96e-22
Family Protein kinases, catalytic subunit 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015101   Gene: ENSGACG00000011424   Transcript: ENSGACT00000015129
Sequence length 234
Comment pep:novel group:BROADS1:groupXVII:12396582:12397516:1 gene:ENSGACG00000011424 transcript:ENSGACT00000015129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQETSMALQEFLSQAELIKQGAEARVYRAQFLGKPTILKQRFPKRYRHPLLDEKLTHRR
TVQEVRSILRCRRAGISAPVVYFVDYASHCIFLEEIVGSSTVRDYIASTRRSDASEDLGW
LAERVGQILARMHDEDVVHGDLTTSNMLLRHGLEDGESELFLIDFGLSYISALPEDKGVD
LYVLEKAFLSTHPSTEALFQRLLKSYAAASSKSSAVFKKLDEVRLRGRKRSMVG
Download sequence
Identical sequences G3PBX7
ENSGACP00000015101 ENSGACP00000015101 69293.ENSGACP00000015101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]