SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016020 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016020
Domain Number 1 Region: 3-204
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.07e-44
Family Reprolysin-like 0.0024
Further Details:      
 
Domain Number 2 Region: 299-355
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000157
Family TSP-1 type 1 repeat 0.00027
Further Details:      
 
Domain Number 3 Region: 984-1048
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000916
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 4 Region: 1192-1298
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000393
Family Spermadhesin, CUB domain 0.011
Further Details:      
 
Domain Number 5 Region: 661-726
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000589
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Domain Number 6 Region: 937-990
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000484
Family TSP-1 type 1 repeat 0.01
Further Details:      
 
Domain Number 7 Region: 869-930
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000051
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 8 Region: 729-786
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000419
Family TSP-1 type 1 repeat 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000016020
Domain Number - Region: 812-870
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000144
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 
Domain Number - Region: 617-655
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000196
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 
Domain Number - Region: 1083-1181
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.017
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016020   Gene: ENSGACG00000012089   Transcript: ENSGACT00000016051
Sequence length 1298
Comment pep:novel group:BROADS1:groupXIII:13880431:13888437:1 gene:ENSGACG00000012089 transcript:ENSGACT00000016051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITHLELLVVVGPDVQQFHKQDTERYVLTNLNIASELLRDMALGANMRVHLVRMIILSEPE
PEIQMSPNITSSLRSVCDWGRRINPSNDTDPLHADLLLYITRYDLLLPDGNNQVRGVAQL
GGACSSEWSCVITEDTGFDLGITITHEIGHSFGINHDGVGNTCSKSGFMMASDGGYNSVD
LTWSPCSRQQLLTFFTEGKAECVKDLPALGGSLQHWKPGLYYGVDDQCRIAFGSTARACS
FTNPDLPACRVLSCHINPDDNSSCKRLLIPLLDGTECAPDQWCLKGRCVSSDELGSSVVV
HGSWSNWSEFSPCSRTCGGGVTQRTRKCNNPRPAFGGNDCEGSDIEAELCHQQPCENTQL
DFVAEQCSQTDLHPLYLLPNTASFYTWIPAIGPSPGDDQCRYLCQSKGENFMVSRGSQFV
DGTRCESDRPPLFGSTAACLRGKCQLFGCDGTLHSGKVRDVCGVCGGDASSCSLTSDSYG
GGQAREYTTFLSLPVNATQVHVVNRAPLFTHMAVTVGDRYVVSGMGEMALTTTHPSPLDD
NRLEYSLHLTPDLLPAMETLFLPGPLAEEINVQVYRKYGKEYGEKTNPNISYHFYVPLSN
SNLTENSPKGKWSVFTTPCSVSCGPGVQKQVYVCVDEENNKHLDEHNCETPPPPKRLPTT
CQLSRCPPSWDTGAFGPCSASCGGGERVRPVRCVQRHGAAVMKVSDTECPPDMAPDAGEK
CNLQRCPARWRVSEPGKCVAVCGPGEAKRNVSCVRPEDGRDVEVDEMFCSLEIKPTDYVS
CVVDVCPIGWQFKGEEQQVLKSAASPRSKQAPVYVWSPVISQCSKACGNGTLQVWFSCLD
HQTRLRVTDILCDTSTRPLPQTETCNTTPCPPTWRSKQGVCSVTCGGGVANRVLYCAMET
DGEEEVVVEDSGCNEFPRPTPVVACNNHSCPARWTVVSSSACSASCDLGVAQRTVSCVQF
FHGKESVVPEESCHAAVKPANAGPCLVQVCTFRWDVKPWSQCSVPCGYGIQSRAVSCVGP
SKPGPLSPLFCMHMPKPITIQGCYLGGCLLSTSDAPQVTSQHPSDRLSPTDPVLAPQATT
TTVPTRACGQLLLEESGTVHLKDVIGRCTVSIGRPLDEVIHIRVESGSLNCMKKEFVVFF
DRLAFVRKCEQVVGSELTTRTNVLLVRQKLLTPGNGVVLTYNSQKNPKKNHHQDCDIQLF
SPNGVFENPTTPNTNHTCRVLINAPPSVKIRIQALHIGSVSNATIAQATYIMIRDMNVLT
TNVFKGRQLFQWQSSGNMAEIEFHGGHLHSKGSFRAKY
Download sequence
Identical sequences G3PEJ6
69293.ENSGACP00000016020 ENSGACP00000016020 ENSGACP00000016020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]