SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016047 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016047
Domain Number 1 Region: 14-198
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-50
Family SPRY domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016047   Gene: ENSGACG00000012132   Transcript: ENSGACT00000016078
Sequence length 219
Comment pep:novel group:BROADS1:groupVI:16590500:16621155:1 gene:ENSGACG00000012132 transcript:ENSGACT00000016078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRVEPDGVRWLTPGLRKYSCELTIDTNTVNKQLKLSDNNRKVTCVEEDQSYPDHPDRFDI
RAQLLCRTGLTGRCYWEVEWRGDVTVSVSYRGIKRKGNSGDCLFGRSDQSWSLKCRHEGY
SVCHNKTETFITSSSSSSSSSGRLAVYVDCPAGSLSFYRVSSDTLIHLHTFSTTFTKPLY
PGFGFWSRSGSSVSLCSLQEGESPPAGEPSSLLTMRLSP
Download sequence
Identical sequences G3PEM3
69293.ENSGACP00000016047 ENSGACP00000016047 ENSGACP00000016047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]