SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016093 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016093
Domain Number 1 Region: 76-264
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.27e-27
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 382-424
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000523
Family SOCS box-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016093   Gene: ENSGACG00000012153   Transcript: ENSGACT00000016124
Sequence length 437
Comment pep:novel group:BROADS1:groupXIII:13909600:13913900:-1 gene:ENSGACG00000012153 transcript:ENSGACT00000016124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFLHGFRRIIYEYQPLVDAVMCVVGLEEGDDSLPLKDRHLNISIIEVLSPEEVCGSLAE
LLERESQSDMFVEGISYALFKVAERGLVTAAEILLRYGADLNFEDPVSYYNPLHVAVLRN
RPSIVRLLVEHGASVEKRDRIHESSPLDLASEESERLTCLLTLLDLGADVNAMDKHGKTP
LLHAFASSDGLTVHNTENIRLLLQRGADVNASTVEGETVESALVFLIKEALEANTEDAAE
IGNFCLKTTELLLAHGVDPSCCLNADGEPSLTQTSLEHFDLLFPLAVLLIQSGASLVCSH
HGESCWSGYSLLLRRLQTALRHCSDGSRSSELLEQAEALLDLARVDAPMLHLPLRLELPV
PGRDPHPHAQALADLHDRVVQYEASPPSLRCLCRSFIRSRLQPWPLVDRFKALPLPDRLK
DFILPERTYTPKSGWDR
Download sequence
Identical sequences G3PER9
69293.ENSGACP00000016093 ENSGACP00000016093 ENSGACP00000016093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]