SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016470 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016470
Domain Number 1 Region: 1776-2034
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.07e-52
Family Ankyrin repeat 0.000000054
Further Details:      
 
Domain Number 2 Region: 548-678
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000157
Family Growth factor receptor domain 0.0076
Further Details:      
 
Domain Number 3 Region: 410-452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000179
Family EGF-type module 0.0011
Further Details:      
 
Domain Number 4 Region: 1053-1187
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000471
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 830-948
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000494
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 448-490
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000911
Family EGF-type module 0.0036
Further Details:      
 
Domain Number 7 Region: 711-754
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000158
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 8 Region: 749-787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000464
Family EGF-type module 0.007
Further Details:      
 
Domain Number 9 Region: 253-291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000214
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 10 Region: 214-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000268
Family EGF-type module 0.014
Further Details:      
 
Domain Number 11 Region: 982-1020
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000375
Family EGF-type module 0.004
Further Details:      
 
Domain Number 12 Region: 944-986
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000196
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 13 Region: 370-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000251
Family EGF-type module 0.0017
Further Details:      
 
Domain Number 14 Region: 1195-1237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000522
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 15 Region: 133-251
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000549
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number 16 Region: 486-522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 17 Region: 98-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000324
Family EGF-type module 0.012
Further Details:      
 
Domain Number 18 Region: 668-712
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000114
Family EGF-type module 0.018
Further Details:      
 
Domain Number 19 Region: 1395-1427
Classification Level Classification E-value
Superfamily Notch domain 0.000000196
Family Notch domain 0.00072
Further Details:      
 
Domain Number 20 Region: 62-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000025
Family EGF-type module 0.011
Further Details:      
 
Domain Number 21 Region: 1479-1510
Classification Level Classification E-value
Superfamily Notch domain 0.000000275
Family Notch domain 0.0024
Further Details:      
 
Domain Number 22 Region: 1268-1307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000518
Family EGF-type module 0.016
Further Details:      
 
Domain Number 23 Region: 1311-1347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000589
Family EGF-type module 0.009
Further Details:      
 
Domain Number 24 Region: 287-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000697
Family EGF-type module 0.013
Further Details:      
 
Domain Number 25 Region: 12-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000084
Family EGF-type module 0.013
Further Details:      
 
Domain Number 26 Region: 1022-1065
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000214
Family EGF-type module 0.027
Further Details:      
 
Domain Number 27 Region: 332-374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000293
Family EGF-type module 0.015
Further Details:      
 
Domain Number 28 Region: 1227-1268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000363
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 29 Region: 1436-1469
Classification Level Classification E-value
Superfamily Notch domain 0.00000405
Family Notch domain 0.0065
Further Details:      
 
Domain Number 30 Region: 524-559
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000162
Family EGF-type module 0.013
Further Details:      
 
Domain Number 31 Region: 1350-1388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000257
Family EGF-type module 0.018
Further Details:      
 
Domain Number 32 Region: 790-850
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000652
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016470   Gene: ENSGACG00000012442   Transcript: ENSGACT00000016502
Sequence length 2459
Comment pep:novel group:BROADS1:groupVIII:15749226:15764692:1 gene:ENSGACG00000012442 transcript:ENSGACT00000016502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAPGFLGEYCHHKDPCHPGFCLNGGDCSVSMSAGVPVPGSAACTCPLGYTGQHCQTPQNS
TCYPNNPCANKGVCALLSLDKYKCKCPRGWTGPQCEHEDSCLSSPCANGGKCSSPSAGSY
TCSCPPGYEGPRCLNDTNECAASPSICQNEGRCVNTPGSYKCTCDPGFTGRHCESSYIPC
SPSPCLNGGTCHQNTETSYSCHCLPGFNGTNCENNIDDCPGHQCANGGTCMDGVNTYNCQ
CPPEWTGQHCTEDVDECRLQPNTCQNGGTCSNLFGSYVCVCVNGWSGLHCSENIDDCATA
ACSPGSTCIDRVASFVCLCPYGKTGLLCHRDDACISNPCREGSQCDTNPISGMFNCNCAP
GYVGSTCNIDRDECSIGTNPCEHGGQCVNTDGSFTCNCVRGYAGPRCEQDVNECASNPCQ
NEGTCLDRIGDYTCICMPGFEGTHCEVEINECISSPCLNQGKCLDQVSRFVCECPAGFSG
EMCQIDIDECSSTPCLNGAKCIDRPNGYDCECAEGFTGLLCGDNINDCVPEPCHHGSCKD
GIATFSCECDPGYTGSICNIQVQECHSNPCQNRAHCVDLVNGYQCNCPTGTRGVNCEINE
DDCDSNPCEYGECQDGIDEYKCVCAPGYTGLKCNVDINECSSNPCMSGGTCIDKVNGFHC
LCPPSTHGPLCLSGTDHCAPQPCVHGECIEQQHGYRCECEAGWVGQHCEQEKDECRPNPC
QNGGACVDRHNGYTCQCQPGFRGVSCEKNIDECASGPCLNHGLCLDGVSSYSCQCSPPFT
GKHCEVEQVPCASHPCERGGVCRPSPDYTSYTCRCPAGWQNCAGPRCSEDVDECKKNPCR
NGGRCVNNQGSYTCRCQPGYSGHNCQTDIDDCSPSPCQNGGSCVDDVGSFSCDCRQGFEG
ERCEMEVDECASQPCRNGAVCRDYVNSFVCECRPGFDGILCERDILECTESSCLNNGTCI
DEVNAFSCRCRPGFYGTFCEYEQNECDSQPCKNGGTCTDGLGSYRCTCSMGYNGQNCQQN
FVNLCSQVRCLNGGSCSQTSTSWTCHCQMGWTGLYCDVPNMSCQDYAARNGREVENVCEN
AGRCINVGHSHRCQCQPGYTGSYCKEMVDECQSNPCRNGATCKDYQGTYECICKPGYQGV
NCEYDVDECHSRPCLHGGTCINLINRFTCACPPGAHGLQCEVNEDECAAKAGSFEPRCLN
GGQCVDGVGRYSCSCPPGFVGEHCEGDLNECLSGPCHAPGSLDCVQLVNDYQCRCRLGYT
GRHCESMVDLCLSKPCHKGGVCSMNMSSVHGYTCSCVPGFTGFNCGEIEGYSCAKLRCQN
GGRCVESTGRLSCQCQPGFSGPHCENEHRCPWNCQNGGTCVKDPSNPYQYSCRCAAHFSG
PYCESGQQIVPRTPTCRYPQCEQHSRDKVCDAQCNNHECQWDGGDCSLNWQQPWVNCTAS
VPCWDLFKNGLCNKECDNPGCLFDSFECQETPASCKYVTYDRYCADHFGNGDCDPSCYTE
ACGWDGLDCSIDTPAKVIDGTLVIVVRLQPKELLGDLRGFLRSLGALLHTNLQVKLDQNN
KPMVYPFYGEEHGLHIQRRRSKRELEKEVIGSVVHLELDNRECSQSSVDCFSNTDEAASF
LAAAHIKAELPYPLVSVKSEPSVNPPPPRALMYLVGLAVVITLLILVLGMLAAKRKHKHG
ALWLPDGFLANKNDKRREPVGQDDFDMKNFKTQDGALIDGVQSQRWLKDEVPSKKQRTED
KPLLPIAMEGSVDRREWTLQHRKAADISLTPPQADLDADCLDVNVKGPDGFTPLMLASLR
NGGGPDCSLHAAEEEEESGGDEPGPSVISDLIAQGASLMAQTDRTGETALHLAARYARAD
AAKRLLDAGADPNGHDNMGRTPLHAAVAADAQGVFQILIRNRATELDARMNDGTTPLVLA
ARLAEEGMVEELIHCHADINAVDDHGKSALHWAAAVNNVQATLVLLKNGANRDMQDNKEE
TPLFLAAREGSFEAAQVLLDHYSNRDITDHLDRLPRDTAQERMHHDIVRLLDQYNLVHSP
HGPNHMGGGGNSSVMCGANGVGFIGMRPGPQGKKSRRGGGGAKVGGAGGGAKELKDMKAK
RRKKPPGGEGPVVGAGGAGGGGGGAAGTGGGNANGAKAAAGLPESSVTMSPVDSLESPHS
YTGDVSGAAATTANSPPLMSSPTSRPMLPPVSHMLGQQPGWGGMTKHGYGGHMFGHVSHQ
MGGSHPGMSQHHVQGPMLSTMNVTMSREQLPPIVTFQMMAPGGGQAMLKPPQPGQVQVTQ
SQGQSQNQGHAQQGAGHLRCPQGMMYRMSEQMSMAHGLPHALQHPHAVSHGGHAGIEAQS
RPLPSYPPMQSPVDKYPTPPSQHSYTTTGSEGTTPGHSAHPPSEHPYLTPSPESPDPWSS
SSPHSNSDWSDVTTSPTPLGNTTHCRLRTTHTFQSRRSSSRRPSRCSRPLSRLSTATCR
Download sequence
Identical sequences G3PFU6
ENSGACP00000016470 69293.ENSGACP00000016470 ENSGACP00000016470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]