SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016575 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016575
Domain Number 1 Region: 193-412
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.18e-49
Family Reprolysin-like 0.0071
Further Details:      
 
Domain Number 2 Region: 505-555
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000497
Family TSP-1 type 1 repeat 0.00057
Further Details:      
 
Domain Number 3 Region: 928-984
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000968
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 4 Region: 820-877
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000085
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 5 Region: 756-817
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000034
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 6 Region: 879-923
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000288
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016575   Gene: ENSGACG00000012531   Transcript: ENSGACT00000016608
Sequence length 1050
Comment pep:novel scaffold:BROADS1:scaffold_98:212590:277779:-1 gene:ENSGACG00000012531 transcript:ENSGACT00000016608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTDEVVPRLLSGQEAHLSSGRSASPPWRRGQRSTDAPRGRHSDPAQIIVSLTAFGMRLYL
NLTWDSTFISGDFEVEERRGDQSAASSRLSKKQLCFYSGSVINHTGSVASLSTCGGLTGL
IQIREESLFIQPVGEYGPYQSFSGMKHWLLRHQRCATTSSSPDGNCWIVRGKEKMPNMGE
KGRRKRNVLHLQEAYTVETVVVADSNMVQYHGAEAAQRFLLTVMNMVYNMFQHKSLGVKI
NIRVTKLVILHSRPEQLKVGHHGERYLESFCHWQHQEFGRLRYLGTDHFPGGWEDIPPVD
TAVLVTRTDFCVHKDEPCDTVGIAYLGGVCSAKRKCALAEDNGLNLAFTIAHELGHNMGM
SHDDDHATCTSHSHIMSGEWIKGRNPSDLSWSSCSRTDLENFLRSKASACLQQTDSRSRY
QIRLPPKLPGMHYSVDQQCQILFGTNASFCSNMEHLMCAGLWCLVEGDAACKTKLDPPLD
GTECGPDKWCRSGKCVNKTPIPQHVDGDWSPWSQWSVCSRTCGTGVHFRQRKCDNPPPGP
GGRHCQKANVEHKACERPPCPNGATGFRDQQCLSYDQHGSKNKGLLTAIINDEKPCALFC
SPVGRDVPVLMADRVMDGTPCGPYEADLCVNGRCQKIGCDGIVGPTAKEDHCGVCNGDGR
SCKIASGKFTHTKGMALRDSIKRSINSDWKIELPGEFELAGTTVHYVRRGLWEKMSAKGP
TKTPLHLMVLLFHDQSYGIHYEYTVSLNTTQDSDTHLYIWTHSNWQDCTVKCGGGERRTV
VSCVRIANKTMEAVNNSYCHPENRPLPKVRLCNSQPCQYRWLTGEWGSCSITCGKGLQHR
EVVCVYHLQNGSRIHTRDLYCQGGKPPVLQACEGHLCLTVWEASEWSKCSSDCGQGVHKR
TVSCTNPEGVCDPFSRPKEEEPCEDLSKCYEWKTGDWSKCSASCGKGLQSRVVQCMHKLT
GRHGNDCSVMLRPPTYRPCHQGTCIDQINVNRVASLPSCSDLLMHWDQWCCRVIRETNLC
QDMRWFQRCCETCGDIYAKKMLKKGKMPSA
Download sequence
Identical sequences G3PG51
ENSGACP00000016575 ENSGACP00000016575 69293.ENSGACP00000016575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]