SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016708 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016708
Domain Number 1 Region: 467-705
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.27e-56
Family Eukaryotic proteases 0.0000213
Further Details:      
 
Domain Number 2 Region: 105-206
Classification Level Classification E-value
Superfamily Kringle-like 2.34e-31
Family Kringle modules 0.00011
Further Details:      
 
Domain Number 3 Region: 208-289
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-30
Family Kringle modules 0.00016
Further Details:      
 
Domain Number 4 Region: 294-382
Classification Level Classification E-value
Superfamily Kringle-like 1.14e-29
Family Kringle modules 0.00016
Further Details:      
 
Domain Number 5 Region: 387-465
Classification Level Classification E-value
Superfamily Kringle-like 9.67e-22
Family Kringle modules 0.00074
Further Details:      
 
Domain Number 6 Region: 27-117
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 1.29e-20
Family Hairpin loop containing domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016708   Gene: ENSGACG00000012640   Transcript: ENSGACT00000016742
Sequence length 712
Comment pep:novel group:BROADS1:groupXIX:16212950:16226790:-1 gene:ENSGACG00000012640 transcript:ENSGACT00000016742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRAAAMWIYQLVFGLFVVSFCEGKQNGNALQDYQKTDGVRLVVASPDSSLLTESKKRSLA
KCAKACSRNKIIPFNCRAFLYDHTNRKCQWLSFDTRSPGAQSQQDFNYQLYQKKDYVREC
IVGTGESYRGRRSTTVSGIRCQAWASPIPHEHNFMSKRFRKKDLRENFCRNPDNSSVGPW
CFTTDPRAELRHQQCGIPQCSQVLCSCCCNGEEYRGPMDHTESGKECQRWDLNDPHKHQY
HPKRYPDKGLDDNYCRNPNGRHKPWCFTTDPNTPWEYCDIKVCETSPKSNVVETTECYQG
RGEGYRGTVDVMPTGLICQRWDSQYPHNHTFTPQAYPCKDLRENYCRNPDGREFPWCFTT
DPRVQTMFCTNIPQCGTQNNPVSGPNPDCYEGFGENYQGEQSRTRSNLPCAPWRDRNNRS
AHWIGGLEGSYCRNPDKDKHGPWCYTNNSAVPWDYCHIKPSELSSVGCFVHKRTRIVGGG
PVGVLDGSWMVSIQKGSQHWCGGSLIREEWVLTDRQCFSSCVPDLSEYRVWLGVLDIGEG
APDWSKRQEVNIADVICGPEGSSLALIRLSKPALPADNVHTLQLPVAGCSIPEGTICKMY
GWGETKDTGHDDQLKAVDLPIVSNVRCREMHRGNLHITNTKICAGGKRNEGVCERDYGGP
LVCQDGEIRVIVGVSVHGRGCARANQPGIFINVPFYTQWIYKVFKYYPNPDI
Download sequence
Identical sequences G3PGI4
69293.ENSGACP00000016708 ENSGACP00000016708 ENSGACP00000016708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]