SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016748 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016748
Domain Number 1 Region: 175-310
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000124
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 2 Region: 87-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000907
Family EGF-type module 0.02
Further Details:      
 
Domain Number 3 Region: 1-33
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000142
Family EGF-type module 0.013
Further Details:      
 
Domain Number 4 Region: 123-165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000373
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 5 Region: 47-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000256
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016748   Gene: ENSGACG00000012669   Transcript: ENSGACT00000016782
Sequence length 856
Comment pep:novel group:BROADS1:groupXI:12189553:12195571:-1 gene:ENSGACG00000012669 transcript:ENSGACT00000016782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INECTTAGICGPNAQCNNAIGSYSCTCLDGFNATDPISAPGLSNKCTGFCGPDAECNNTI
GSYSCICLDGFSATDLTLPPGLSNECTDIDECTTADICGPDAECNNTIASYSCICLDGFS
PTDPKCLADVDECGIDPPICGPYANCSNSDGSYSCTCFVGFQENVTGVIASSSNPCTDID
ECFNSTICGPDSECTNIPGNYTCKCVLGYAPTDQNRQPSETNICIDVDECDITPPICGPY
SNCSNSIGSYSCTCFSGFRLNQQNLIASYSNPCTDIDECSETPGLCGILTVCTNVPGTYY
CSCRDGFYPSTGLVWKIGVTFCESELRMRLLQVYINTDSTGLDVILVRRCCWMFLNLMQI
MCSCINKTTVSNSISASMEVSGVGPRARLRSVSSQGDAETGSMILNISDRLVSAIVQPGQ
NKTQRTVTSPTLVDLSIQTIGPEDSDAESTALSANGNTMQINLEGLAKNNNGSAAVAFLT
INGMESLLSHQYFKTENRTEMYSDVITAVLPLMNNTNLTEPVNFTIQHKKTLTESGLVTC
VYWEESADGKTQDKRWSVDGCLVAYTNENYTVCSCSHLSTFALIMQIGEPPQEDSFLEWL
NRMCVTIGLFFLALAIFTFLLCSWNPKINNTARLHLCLNLFFSQLLLLWNDKNTSVCPQR
ACTVMAGVLHFVVVASFVWMLLEALQLHLLVRRLSKVQVIQRDGLPRPLLYLIGYGVPFV
IVGASALIYSDGYGATDAKVCWLSTKRHFNWALTGPVVAILGLNWILFCATLWSLRPTLV
NMKSGASQSKDTRLVIFKILSQFVILGCTWILGLYQSNLFFQVLFIVLNSQQGTFLYIVH
CLLNKEVRDEYVKWLT
Download sequence
Identical sequences G3PGM4
69293.ENSGACP00000016748 ENSGACP00000016748 ENSGACP00000016748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]