SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016766 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016766
Domain Number 1 Region: 4-113
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.32e-16
Family Ricin B-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016766   Gene: ENSGACG00000012687   Transcript: ENSGACT00000016800
Sequence length 116
Comment pep:novel group:BROADS1:groupI:16390297:16391939:1 gene:ENSGACG00000012687 transcript:ENSGACT00000016800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKENHTATLHPCHGWGPQLGRYTKEGQLFLGPLGSTGDDTRCVVDDQISSFPQLLNCDKL
TNVKQKTWHFSQNESLINRATGRCLEVVPANVYFGHLLVLQPCSGQRWTIKNTMKQ
Download sequence
Identical sequences G3PGP1
ENSGACP00000016766 69293.ENSGACP00000016766 ENSGACP00000016766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]