SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016862 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016862
Domain Number 1 Region: 58-148
Classification Level Classification E-value
Superfamily Immunoglobulin 7.23e-19
Family C1 set domains (antibody constant domain-like) 0.0094
Further Details:      
 
Domain Number 2 Region: 156-204
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000308
Family C1 set domains (antibody constant domain-like) 0.026
Further Details:      
 
Domain Number 3 Region: 3-44
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000225
Family C1 set domains (antibody constant domain-like) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016862   Gene: ENSGACG00000012767   Transcript: ENSGACT00000016896
Sequence length 211
Comment pep:novel group:BROADS1:groupXI:12326300:12327385:-1 gene:ENSGACG00000012767 transcript:ENSGACT00000016896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEDGRVVVTSHLHVPQSEWRTGKVFTCEVSDKSLNANVRKNISLCSVTPASSQIVAVYV
QGPTPAELLNKGQVTITCLLVGPSLNDFSVTWKVGENNHSHDGREDFPVSHSNGTETVQS
FLNVSAADWNEFKRVSCEAKHRCSKLGHEDHITKSRVKITQPTVDDLSTSDSLAIICHVS
GFFPSDIRVYWEEEDQRVPPTHFTNSPTWKY
Download sequence
Identical sequences G3PGY7
ENSGACP00000016862 ENSGACP00000016862 69293.ENSGACP00000016862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]