SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016944 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016944
Domain Number 1 Region: 418-464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000199
Family EGF-type module 0.014
Further Details:      
 
Domain Number 2 Region: 595-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000708
Family EGF-type module 0.018
Further Details:      
 
Domain Number 3 Region: 451-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000318
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 4 Region: 691-723
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000036
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000016944
Domain Number - Region: 787-819
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000258
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 658-691
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000762
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 723-754
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00133
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 754-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00727
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 627-657
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00894
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 124-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0192
Family EGF-type module 0.078
Further Details:      
 
Domain Number - Region: 562-593
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0203
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016944   Gene: ENSGACG00000012820   Transcript: ENSGACT00000016978
Sequence length 823
Comment pep:novel group:BROADS1:groupXX:14700027:14709971:1 gene:ENSGACG00000012820 transcript:ENSGACT00000016978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLSQSDLEAFTYFFPEDHEAAAPPDAFPKWPTPSGLTERRAGTQCRQAVAGSGVALGCRS
LLDQSIISRAEAMCVADLRLKDEQSWLNAAVPLLENECERRLTEERGGGTEYQDVLAVLR
CPDLCNGNGQCSERGCVCFPGFGSYDCGVLSDQIPEITELEKEGLCDVRQGDCSPLRVHG
QGFKDSYELKCEFVKEKFEDGAWLLDEPRFVPAVFLDVTALECRLPPDDSRTPAGPQPET
ETDRPLARWQIKVSNDGYSFSNAKILTLYDGACQICSLHTPVLCTLRERTCSIDGLCYSE
GESSPSSACLACRPDSSKHTWSIAEKNKPPQLQSLPLRLQSFQGESFVYQLQARDPEGSV
VLFTLESGPEGASLSPAGLLAWKTSAEATDAPTFRFTVTDSCGAETRASVQVSVRPCECL
NGATCVTNGDLPRGSGEHLCACPDGFKGERCEVDVDDCKPNPCRLGRCIDGPDSFSCVCP
AGMTGGRRRAEVFPSDHPEVEGSEDSVDLSLQGRTLKRASRDQTNNNITVCRYQCGRNME
CTLPNTCACKEGYTGYSCHIAVCRPDCKNQGKCVQPGVCECAAGYGGPTCEEASCEPPCR
HGGTCLARNLCTCPYGYVGPRCEIMVCNRHCENGGECVSPDVCKCKPGWYGPTCNSAHCD
PVCLNGGACTKPNICACPGGFYGSQCQIAVCSPPCKNGGQCMRNNVCSCPEGYTGKRCQK
SVCEPMCMNRGKCVGPHTCSCASGWRGKRCNIPVCLQKCKNGGECLGPNTCHCPSGWGGL
QCQTPVCKQRCLNGGRCVLPDYCHCRRGYNGLTCALKVSAVFP
Download sequence
Identical sequences G3PH69
69293.ENSGACP00000016944 ENSGACP00000016944 ENSGACP00000016944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]