SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016962 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016962
Domain Number 1 Region: 557-848
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.35e-72
Family Protein kinases, catalytic subunit 0.000000253
Further Details:      
 
Domain Number 2 Region: 2-104
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000076
Family MAM domain 0.083
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000016962
Domain Number - Region: 451-485
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000912
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016962   Gene: ENSGACG00000012839   Transcript: ENSGACT00000016996
Sequence length 1037
Comment pep:novel group:BROADS1:groupXV:13391664:13436782:-1 gene:ENSGACG00000012839 transcript:ENSGACT00000016996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAILRSPLFPPPLRNSPCTVRFWLCSGGLQQRSLSLWIASNGTGAKEQRRLWHLVSKPVS
EYGWKVVRIPLYGLADWFWLQFSAEDGPGPGSAITIDNISFSMDCFLAFIIRLEDFIWTD
RQDHAPVHRKSFDEPPQHRFLDGGSSNSQTESASPRVKKWTFHTCGAVGPEGPTPTQCLN
SYRKSNVNVTVGTRGPFKGIQMWQIPKTGSYRVTAYGAAGGRSVLAMSRSHGVCITGDFL
LRRGELLYILVGQQGEDACPNSNGMLNRICLEQSGPMVNKTQVKGGGGGGGGATYVFKVD
KGVYIPLIIAAGGGGRGYSSLSETQLEQMDYDPSQPGRSGKSNAAGGGGGWNDRTPVSQG
GRPLVLGGQGGQACQKFWQTRGGFGGGGGGCMSGGAGGGYRGGNTSVDNNPKHDGDDGTS
FLGPEGQPFLYPLKAVEGDGEVVISPVQNCSHCESDECHETKGGIVCYCDEDLVLDPNGV
SCINATVVSSLHPQPTLSHLALGLSVGTSALIAALLLTVSGVMIMYRRKHTELQSIQLEL
QSPDCKLSKLRASTIMTDYNPNYCFAGKTASVNDLKEVPRRNISLTRGLGHGAFGEVYEG
LAVAIPGEPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFSHQNIVRCVGVSLQAMPRF
ILLELMTGGDLKSFLRETRPRLEHPSSLTMVDLLNVARDIAKGCQYLEENQFIHRDIAAR
NCLLTCKGPGRVAKIGDFGMARDIYRASYYRKGGRAMLPVKWMPPEAFMEGIFTSKTDTW
SFGVLLWEIFSLGYMPYPSRSNQEVLEFVTNGGRMDPPKNCPGPVYRIMTQSWQHQPEDR
PNFSTILERIDYCLQDPDVVTMPLPEEYGPIPEEEERVPMRPEDSSEPTVQLNAQFCNGC
SPPPHPIYLMTAARATPHSIPRGHTSPLSPGPEGGHITLAFTQGHVPERDAHNREKTSLW
NPTYGSWFLQQRKQQQRQGGVGGVCRPLLPPPPPPAAQSPLLLDSATLPPVPLYRLRRFP
CGNIGYGYQEQGLQLEA
Download sequence
Identical sequences G3PH87
ENSGACP00000016962 ENSGACP00000016962 69293.ENSGACP00000016962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]