SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017015 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017015
Domain Number 1 Region: 88-144
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000196
Family TSP-1 type 1 repeat 0.0063
Further Details:      
 
Domain Number 2 Region: 240-302
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000183
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000017015
Domain Number - Region: 152-226
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00157
Family TSP-1 type 1 repeat 0.0079
Further Details:      
 
Domain Number - Region: 52-89
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00432
Family TSP-1 type 1 repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017015   Gene: ENSGACG00000012883   Transcript: ENSGACT00000017049
Sequence length 354
Comment pep:novel group:BROADS1:groupXX:14771780:14785957:1 gene:ENSGACG00000012883 transcript:ENSGACT00000017049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTARQVKRRKGKGQGLRERAGVKDPETRELIQKKRTRNRLNRQESPFWDIQVGYQTREVT
CIHRNGSAAGRNLCAPWDPPLTMRPCVLPKDCQLTDWAEWGPCSKTCLDPASPVGARTRS
RQVVQFPVGEGAECAALEDFEACEPQGEGVPPCSSYTWRSTEWSDCRVDPLLGQQDRRRG
NLTGLCGGGLQTREVYCVQANAELLKYLDDLREKDQASRPVENKMCKGPIPNRSQLCQIP
CPIDCEVSPWGAWGPCTFENCEDQAGKKGFKLRKRRITNEPTGGPGNCPHLVEAVPCDEP
RCYDWRLVGLDRCVPGDGTPCGAGAQLALFRCVNGNEFRDASRSPSGCGQILKK
Download sequence
Identical sequences G3PHE0
ENSGACP00000017015 ENSGACP00000017015 69293.ENSGACP00000017015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]