SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017186 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017186
Domain Number 1 Region: 187-233
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000166
Family Ovomucoid domain III-like 0.0054
Further Details:      
 
Domain Number 2 Region: 91-156
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000107
Family Ovomucoid domain III-like 0.0014
Further Details:      
 
Domain Number 3 Region: 24-66
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000484
Family TB module/8-cys domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017186   Gene: ENSGACG00000012995   Transcript: ENSGACT00000017220
Sequence length 250
Comment pep:novel group:BROADS1:groupVIII:16649364:16651755:-1 gene:ENSGACG00000012995 transcript:ENSGACT00000017220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFFIPVFGVILSLYQIGKNPASAGMCWLQQSQDQRCDMVLMRGVTREECCASGRLDTAW
SNSSMPMNEVSLLGFLGIVSCKPCKETCEGVSCSPGKVCKMKTGRPQCVCSPDCSHITRR
PAVCGSDGRSYGDECSLLMARCMGHPDLEVMYQGDCKKSCSNVVCPGTHTCVTDQTDSAH
CVMCRATPCPIPSMSEQQICGNDNITYPSACHLRRATCFLGRSIGVRHFGHCNSPPRKPQ
RFEGSEENAV
Download sequence
Identical sequences G3PHW0
ENSGACP00000017186 ENSGACP00000017186 69293.ENSGACP00000017186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]