SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017197 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017197
Domain Number 1 Region: 7-195
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.67e-50
Family Astacin 0.00015
Further Details:      
 
Domain Number 2 Region: 366-521
Classification Level Classification E-value
Superfamily TRAF domain-like 1.8e-30
Family MATH domain 0.0016
Further Details:      
 
Domain Number 3 Region: 203-368
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.49e-26
Family MAM domain 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000017197
Domain Number - Region: 547-586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000994
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017197   Gene: ENSGACG00000012999   Transcript: ENSGACT00000017231
Sequence length 643
Comment pep:novel group:BROADS1:groupIII:485478:489708:1 gene:ENSGACG00000012999 transcript:ENSGACT00000017231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNSIIGDEYRWPKTIPYYMEEDLEINAKGVILKAFEQYRLKTCIDFKPWSGEANYISIFK
GSGCFSSVGNRHVGKQRLSIGTNCDRIATIEHEFLHALGFWHEQSRADRDDYVNIMWDRI
SDGKEHNFNTYDDSTSSSLGVAYDYGSMMHYSKNAFRNGTEPTIVTKIPAFSEVIGQRME
FSDSDLLKLHRLYNCTQGSTFLDSCDFERENVCGMVQGQEDMADWVRVTKADGGPDTDYS
NVGKCTGSGYFMHFNASAASVGDAAVLESRLLYPKRGYQCLQFFYYHSAGANAALRIHVR
EYDEANPDGKVRLVKIIEGPPAEQWQLHHVSLDVKTKFRVVFQGTKEASGPSTGGLSLDD
INLSENTCPEFIWRVKNFSQVMESTAANTSIFSPPFTSKEGYTFQMELYPSGKAGYPGEL
SAYAHLVSREGDTGQTWPCPWKQMTMTLMDQHPHIQKRMSNQRSVTTDPDMKATGSDRYF
WDDPRLYFRGPGAGTAVYLTHLRAKSRDFIKGGDAIFLLTMEDVSHLTAVQPLPSTTQQP
ATSGPPEICLNVQCLNDGVCVEDEGTAACRCLVGDDWWFYGNSCQYKGSTMDKTTLALAS
SLSVLGAMLVITVVSVICMKKKYKRRSAVSSVVMGNMSATQKP
Download sequence
Identical sequences G3PHX1
ENSGACP00000017197 ENSGACP00000017197 69293.ENSGACP00000017197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]