SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017238 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017238
Domain Number 1 Region: 260-350
Classification Level Classification E-value
Superfamily Immunoglobulin 3.54e-17
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 93-151
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000034
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 3 Region: 176-240
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000772
Family Pre-dockerin domain 0.035
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000017238
Domain Number - Region: 443-499
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00275
Family Carboxypeptidase regulatory domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017238   Gene: ENSGACG00000013036   Transcript: ENSGACT00000017272
Sequence length 1133
Comment pep:novel group:BROADS1:groupVIII:16820744:16827630:-1 gene:ENSGACG00000013036 transcript:ENSGACT00000017272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EWTSWFNIDHPGGNGDYERLEAIRFYYRERVCARPTAMEARTTDWVAAADTGEVVHSSLE
KGFWCINREQGRGRVCSNYHVRFQCPPGSSETHSYWADWSEWGACSTTVCDDVGIKVRQR
KCVNTQPMPLLLVPACLGHHSERRECSNPPCTAKCQLVCVEGRPSEDCSRCTCDDHVLHG
EVRAVTGVPVAEAWVALDSQPKVIRALTDAKGQFRLEGICSSSSTLISIRKEKFTPVTVS
TSSNGTAWSWVRAVLRSAEKPYIVKHPEDKVRPEGGRVMFCCKATGSPAPDKYYWYHNGT
LLDRKQYKYEEDLVLWSLKPEQSGQYYCKASSSAGSIKSSPALLAVIAKGKPACNSTPET
HLIRLPIDCVQPGTDSMHYNAGRCPHNKCAGSLDFDMRCRDDAGFCCGVHDSESRIIDCG
SYSLPIRAVTQCSCKKCPQPTVLVRGRVVTADNDEPLRFGHIYIGKERAGTTGYQGGFTL
QIPPDTQRLVVNFVDPTERFLDTPKVFILDKKGGSIYHNVKVMRRQTPIDINAGDSNYIS
LGEIEGEDPIGQLVIPPNSFHKDNGEIYEGTVKASVTFIDPRNITTAAAAPGDLNFVDGE
GDMLPLRTYGMFSVDFRDETNKEVLGAGGVQVLLDTQHIKMPEHIPKMKLWSLNPDTGVW
EEESDFAYTTTTPGGHGRSKREERTFLIGNMEIRERRLFNLDVPENRRCYVKVRAYMSDK
FLASEQLEGVVVSLINLEPKPGFSSNPRAWGRFDSVLTGSNGACLPAFCDAQRPDAYTAY
VTAMMGGEELEAAPSTPKMNPNIIGVSQPYLDKIDYQRSDHEDPALKKTAFKINLAKPNQ
NNIDETNGPIYPYANLIGCENAPIDANHFRFFRVEKDKYEYNVVPFEENDLTTWTGDYLS
WWPNPQEFRACFIKVKIHGEKEVMVRSRNLGGTHRETKGQLYGIRDIRSTRDMREANTSA
ACLEFKCSGMLFDQAEVDRSIIAVLPQGNCRRIGTNNLLQEYLIKHPPVAQNNESQGFTM
LAPVDPLGHNYGIYTVTDQNPRVAKEIAIGRCFDGTSDGFSREMKTDSGVGLTFSCPERK
VNRESLFQRLQTNPAQTLSQMARSMRESEGSQAQGSPTRMVAYPSEQQGRTQS
Download sequence
Identical sequences G3PI11
ENSGACP00000017238 ENSGACP00000017238 69293.ENSGACP00000017238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]