SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017266 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017266
Domain Number 1 Region: 358-542
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.94e-64
Family SPRY domain 0.00000491
Further Details:      
 
Domain Number 2 Region: 142-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.04e-18
Family B-box zinc-binding domain 0.00057
Further Details:      
 
Domain Number 3 Region: 10-78
Classification Level Classification E-value
Superfamily RING/U-box 2.17e-17
Family RING finger domain, C3HC4 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017266   Gene: ENSGACG00000013061   Transcript: ENSGACT00000017300
Sequence length 548
Comment pep:novel group:BROADS1:groupXIII:15685990:15687633:1 gene:ENSGACG00000013061 transcript:ENSGACT00000017300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAASCLLTEDQFLCSICLDVFTHPVTIPCGHNFCKACITGHWNVNAPPNCPNCKKLFCT
RPELQVNTFISEMAAQFRLSAQQKASSSSSEQRAAQPGEVPCDVCTGTKVKALKSCLVCL
VSYCEAHLEPHLTTSGLKKHQLMDPVENLEGRMCTKHDKLLEVYCKTDQMCVCMLCTVAD
HKNHDVVPLREEYEGKKEELGRTEAEVQQMIQKRLLKIQEIKHSVELNEEAANRQVAEGV
LVFSTLKESVERSQAELINSIDEKQRKTAKQAEGFIKDLEQEISELKKRSTEVEQLSHSE
DHLHLLQSFKTLKTALPTKDWTGVRVSAPSHEGTVVRAVNQLQEMLSKQMKELLEVELKR
VQQSAVDVTLDPDTAHPNLLLSHDGKQVKHGDVKKNLPDNPERFNQCVIVLGKQRFSSGR
FYYEVQVKGKTEWWLGVARESINRKGHVSRTPQDGYWTIRLVNELNGYLACDDPPVDLSL
ESRPGKVGVFVDYEEGLVSFYDVDAAALIYSFTGCCFTEKLYPYFNPCLNNYGTNSAPLI
ISAVNRSS
Download sequence
Identical sequences G3PI39
ENSGACP00000017266 69293.ENSGACP00000017266 ENSGACP00000017266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]