SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017307 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017307
Domain Number 1 Region: 264-499
Classification Level Classification E-value
Superfamily HCP-like 4.01e-49
Family HCP-like 0.00013
Further Details:      
 
Domain Number 2 Region: 469-605
Classification Level Classification E-value
Superfamily HCP-like 1.09e-26
Family HCP-like 0.0057
Further Details:      
 
Domain Number 3 Region: 107-229
Classification Level Classification E-value
Superfamily HCP-like 3.01e-22
Family HCP-like 0.0069
Further Details:      
 
Domain Number 4 Region: 23-75
Classification Level Classification E-value
Superfamily Kringle-like 1.68e-19
Family Fibronectin type II module 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017307   Gene: ENSGACG00000013087   Transcript: ENSGACT00000017341
Sequence length 704
Comment pep:novel group:BROADS1:groupXVIII:15100823:15107505:-1 gene:ENSGACG00000013087 transcript:ENSGACT00000017341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKEDLPEQPPPVVEKPKEVPVVNGGTAHGEPCIFPFLFQGTEYLDCTTDGRGDGRLWCAT
IYDYDHEKKWGFCETEEQAQQRLQAEEAEEEYQTVLRLLNATTRRTQKKELYEKLLKVAE
KGHQKAMEKVAYAMLFGDYMSQNVTKAKDMFDKLAIEGSPKAQTALGFLYAAGLGVNSSQ
AKALVYYTFGALGGNLVAHMVLGYRYWGGVGVPQSCESALTHYRLVANQVANDVSLTGGS
AVQRIRLLDEVENPGSTSGMLEEDLIQYYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQ
RAYDYFTQAANAGNTHAMAFLGKMYSEGSEYLPQNNDTALQYFKKASDLGNPVGQSGLGM
AYLYGRGVPVNYELALKYFQKAAEQGWVDGQLQLGTMYYNGIGVKRDYKQALKFFNLASQ
AGHILAFYNLAQMHATGTGVMRSCHTAVELFKNVCERGRWSERLMAAYGSFKEGESDAAL
VQYLLLAEQGYEVAQSNVAFILDQKGARIITENETYPRALLHWTRAAAQGYTVARIKLGD
YHFYGHGTDVDYETAVIHYRLASEQQHSAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAA
EASPDAQVPVFLALCKLGLVYTLQYLQDLNLKEVISQVDMDQLLGPEWDLYLMTVIALLL
GTVIAYRQRQHQIMVPPRPPVPAPAPPPRPPQEQSQPQAEPQAQ
Download sequence
Identical sequences G3PI80
69293.ENSGACP00000017307 ENSGACP00000017307 ENSGACP00000017307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]