SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017596 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000017596
Domain Number - Region: 56-176
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0282
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number - Region: 359-406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0469
Family Laminin-type module 0.029
Further Details:      
 
Domain Number - Region: 411-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.053
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017596   Gene: ENSGACG00000013308   Transcript: ENSGACT00000017630
Sequence length 1045
Comment pep:novel group:BROADS1:groupXX:16068346:16099436:-1 gene:ENSGACG00000013308 transcript:ENSGACT00000017630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNVQSSAALLLWSFLAGLSFSLDPRDPNVCSLWESFTTSVKESYSHPYDHVTEEPCSDP
RTSYRCTRHRITYKTAYRQAVKTDYRKRFQCCPGYYESREKCVPRCTKECVHGRCVAPDR
CQCEGGWRGDDCSSACDVAHWGPACSHQCRCVNGAACDPAKGTCQCPPGFVGRLCEGSCP
DGTFGTGCLQRCECGTGGSCDEASGECLCRDGFTGTFCEKPCANKCQPRCSCQNGGICKG
KGICDCPPGWTGPVCTVRCPEGRFGQNCADECVCHNRGKCDPETGQCQCAEGFTGNRCNE
ECAAGTYGQDCKGVCKCANGARCYNINGGCLCEPGFSGPHCRDSMCPPGQYGMHCERKCL
CQEKQTLSCHPMKGECTCQPGWAGLLCNETCARGFYGPGCLEPCLCVNGGVCDVATGGCQ
CAPGYTGAHCEHLCKSGTYGKNCSLECACENFVDCSPIDGTCFCKEGWHGPECSAPCSEG
TWGPGCNTTCHCANGAKCSPADGSCTCTAGWQGARCDHSCPMGTFGPGCLKRCDCVHADG
CQATTGECRCLPGWSGPRCSEPCSEGLWGRHCNQTCFKHCPNSDTCLRETGACVCRHGYW
GVTCQNKCRAGMYGDQCGESCPSCGQSYRCHHVSGECDCLPGHTGPDCDQVCPVGYYGKQ
CSQVCVNCANNSTCDHRDGHCECLPGWTATDCSILKNPVGFSPNAGLHIQGFGFTTLHEK
EEELFGLLYIDVLLIYQINQLMVSALQSYYYSCRYIYISYIHHYIFACSPGRFGPFCTQT
CSCPTNLVCDRRTGDCVCGSEGEDCKRSGYKKIEDIHSVKSGSVMVPLPPGERESWGAIS
GIVVLVLLVVLLLALLLLYRRRQRDKQSNTPTVSFSAGRTAGSEYAVPGPTDVPHSYHHY
YSNPSYHTLSQNRPPLPHLPNNHDRTIKNTNNQLFCSVKNMERERRGLFGVESNATLPAD
WKHHEPRKDSGAFGIDRSYSYSASLGKYHHKELKDAVAESSGSLNSENPYATIKDLPGLP
FCPPECSYMEMKSSVPRERAYTEIS
Download sequence
Identical sequences G3PJ17
ENSGACP00000017596 ENSGACP00000017596 69293.ENSGACP00000017596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]