SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017603 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017603
Domain Number 1 Region: 400-665
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-38
Family YWTD domain 0.0000414
Further Details:      
 
Domain Number 2 Region: 345-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000549
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 3 Region: 230-266
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000589
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 4 Region: 65-101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 5 Region: 144-181
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 6 Region: 24-62
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000484
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 109-140
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 8 Region: 195-226
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000038
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 9 Region: 316-356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000148
Family EGF-type module 0.03
Further Details:      
 
Domain Number 10 Region: 277-309
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000288
Family LDL receptor-like module 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000017603
Domain Number - Region: 670-706
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000973
Family EGF-type module 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017603   Gene: ENSGACG00000013316   Transcript: ENSGACT00000017637
Sequence length 706
Comment pep:novel group:BROADS1:groupXIII:16279207:16285577:-1 gene:ENSGACG00000013316 transcript:ENSGACT00000017637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGCMRLCAVLLLWSGLLQVHSISLKCGRGSRMCKDGSDCIPYNELCDGELDCKDGSDEE
DCASECIKDQFQCAHGKKCIDEDQVCDGVPQCQDRSDEMHCKKQSESCVHHCDQNRRCVP
ATFLCDGEKDCLDGSDETNCGTPIKCQLGSRPCQNKFQCVPYNHFCDGEADCKDGSDEEE
CALSCETGNLMTGCDHQCDDNLHCIPKSFLCDGERDCVDLSDEANCAEMGCSPTEFQCVS
GQCMSATMFCDGHPDCQDHSDEDDCATAPVCTTKHSCPQSKQFQCGSQDCVDQIHVCNHN
ADCADGSDEGVSCEIKCAADSRCSQGCYNTPRGPHCRCAAGFRLMEDGLTCADIDECEDR
WPSMCSQLCINTQGSYKCDCHPGYIMETAGRHCKITGEPLLLLSIQTNLFLFGLRSGSLD
MLPSSSAEKAILSLDYDWRDQKVFWVSLDTDGIRWSSLDQKSTGTVIKGVRADSIAVDWL
GRNMYWIDGVNSQIVAIRLRKGTVKSVDHSIILDEDLDQPRSLALLPQKGLMFWTEIGNV
AKIERAGMDGSQRIAVVNSSLGWPGGVAVDAISERVYWTDERLRAIGSATLAGDDIQVTA
FERGYLMKETNNPFSLAVFNDMLYWADARKRVVLAAHKNSGKNLKVLLKRPGQPFGVKVL
HPFLQMGVENPCEKISCSHMCVFAPGPKAVCKCPAGLILAEDGLAC
Download sequence
Identical sequences G3PJ24
69293.ENSGACP00000017603 ENSGACP00000017603 ENSGACP00000017603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]