SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018017 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018017
Domain Number 1 Region: 11-373
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.95e-67
Family Ankyrin repeat 0.0000108
Further Details:      
 
Domain Number 2 Region: 655-963
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.82e-52
Family Ankyrin repeat 0.0000745
Further Details:      
 
Domain Number 3 Region: 1061-1096
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000051
Family SOCS box-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018017   Gene: ENSGACG00000013627   Transcript: ENSGACT00000018052
Sequence length 1107
Comment pep:novel group:BROADS1:groupXVIII:16014622:16035554:-1 gene:ENSGACG00000013627 transcript:ENSGACT00000018052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLSPLQSLIINGDAAALMALVRQSFGGLMEPDNEGWIALHEASFYGQLQCLAILIKAYPD
SVNRCTLKSQTALLLAAGRGNVSCVDFLLKNGASPNIFNKERETPLFAACENPSEDIVAL
LLRSGAQVNRCSLQGTSALHEACRHGQLKLCRLLLEAGGDLRIKNIYGIQSFFIAAQHGH
TDIIKLLAGEGADINEQAGDGASPLFEACKNGHVCGVNALLILKADANLSMKSGLLPLHV
AIQKKHSRIVSLLIPVTSRVRIQHSGISPLHIAAENNSDDIMELLIKSGFDVNSKLSEDR
SKMYKDRRSTPLYFSVYNGNLQATKMLLEAGADPNLDVFNALLIAVQLGRMDMAVLLLKY
GANVNAQISPQLSWFPAALLLKIESLPMFKLLLDNGCDAQPCFNCPYGQKSHPALSPALR
PIEEMRHSREAPPPSCLHFCEAVSSSSFCLAAGPIISLLLDYVSHVCLCSRLLEVLESRS
DWVDIRLKAQTCMKRHSSTMSANISRSEALEDYSLYSNLNDEELLQLAIERSLTDTPYNT
CDRMTSKTAYKTPPQPNSSSLNPEARARNPSRHSSQNPHANYSSHNATSAQATANYSSPN
PPREELPDLYVMTVSHFMTGSGKRMVEYRRTDGSLVVIAPEPEFKILRGQVIGLLSAACE
RNIPAMVAALLNHGAVVNSPCIWGCTALHEASGQNNVEICEMLLKAGAKHNLTNMYGISP
LFNAAQSGQLAALRVLLKHGADINSQAADGATALYEAAKNGHEEIVEFLLSQNANANIPG
KTGLLPLHVAAQRGSDIGKRLFRFNGCREPCYYTYTIVSMLISATSKTRVRRTGISPLHL
AAERNHDDVVELAIEAGFNVNSQLSEERSRLYQDRRSTALYFSVINNNIHAVHMLLEAGA
NPNVDLFRPLLVAARQGCIQIVTLLVEHGADINASLPTHPTTFPAVYMFSMKNLPMFKFL
LDHGGPALSCFNCIYGIRPHPSIKTTRTVRDLSETDSVPQQRGSVQFCEMISAAGIHRWA
GPIIDVLLDYVGHVTLCSRMIYHLDSYSDWSNIKEKATPPRPLLQLCRVQILQLVGQRCL
KKLPLPGGLIRFLQHQEGSVEDCLQET
Download sequence
Identical sequences G3PK87
69293.ENSGACP00000018017 ENSGACP00000018017 ENSGACP00000018017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]