SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018089 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018089
Domain Number 1 Region: 41-158
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000129
Family Growth factor receptor domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000018089
Domain Number - Region: 151-212
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000942
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018089   Gene: ENSGACG00000013691   Transcript: ENSGACT00000018124
Sequence length 225
Comment pep:novel group:BROADS1:groupXX:17223600:17228134:-1 gene:ENSGACG00000013691 transcript:ENSGACT00000018124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLGLVALAMVFVSSVGHGDALRPSRGRRQRRVSTEGPPSCPKGCDRCSEYNGCIKCRPK
LFIFLERNDIRQIGVCLASCPVGYFGMRNPEGNNRCTQCKIDNCEACFNRNFCTKCKEGL
YSHSGRCYVSCPPGQRTANESMECVGQRADECILGEWSQWGSCMKKNKTCGFKKGSQSRE
RVPSQVHSPDASPAPEPSQTCAPQVERRKCSVTKTPCARGKRKIH
Download sequence
Identical sequences G3PKF9
69293.ENSGACP00000018089 ENSGACP00000018089 ENSGACP00000018089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]