SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018162 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018162
Domain Number 1 Region: 1136-1360
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 3.01e-80
Family Fibrinogen C-terminal domain-like 0.00000159
Further Details:      
 
Domain Number 2 Region: 608-773
Classification Level Classification E-value
Superfamily Fibronectin type III 3.67e-23
Family Fibronectin type III 0.0000505
Further Details:      
 
Domain Number 3 Region: 965-1130
Classification Level Classification E-value
Superfamily Fibronectin type III 1.39e-20
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 4 Region: 790-962
Classification Level Classification E-value
Superfamily Fibronectin type III 2.42e-19
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 5 Region: 426-515
Classification Level Classification E-value
Superfamily Fibronectin type III 2.57e-16
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 6 Region: 340-426
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000397
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 7 Region: 515-605
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000125
Family Fibronectin type III 0.0000128
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000018162
Domain Number - Region: 280-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00197
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 249-272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00502
Family Integrin beta EGF-like domains 0.063
Further Details:      
 
Domain Number - Region: 310-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00586
Family EGF-type module 0.069
Further Details:      
 
Domain Number - Region: 218-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00984
Family Integrin beta EGF-like domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018162   Gene: ENSGACG00000013743   Transcript: ENSGACT00000018197
Sequence length 1369
Comment pep:novel group:BROADS1:groupIII:1852860:1900173:1 gene:ENSGACG00000013743 transcript:ENSGACT00000018197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IWYCTGVSSQQSGSLLLLCLLLFRQGAAHAAPSGGNKLVRTTRVRRQTPEGRPPPSAPSA
NESLPEQPLVFNHIYNINVPMEALCSVDLDASAPPAPGDEGPVDHRGPAEYTEQTLDADS
QVTFTHRINIPKAACGCPTTTTIQQLATRVEMLEREVSLLRAQCGSSGCCGESSAMGHLD
FVPGCGGHGSFSFDLCGCICEEGWGGKNCSEPRCLDDCSGQGVCVEGECICDRDFGGDNC
SEPRCPADCSGRGLCVDGECVCEESFTGEDCMVGRCLNDCSDQGLCTNGTCQCRPGYVGE
DCSLVYCANNCSKKGVCKEGFCVCQDGFAGDDCNSVSPVAPAMNVKIRGVTDCTVDVEWE
GSVVLTDFLVTYTPSSPGGVQLEIRIPGNATAYTISGLEAGVEYNINVFAVINNSISVPA
SVTVSTYLSNPDGLVFKYITETSVEVQWLPFYYSFDGWEISFIPKDNDGGMTAQLPSTIT
SFVQTGLRPGEEYTVNLVALRDQGRSQPVTATVLTLIDGPTLLIVRDVSDTVAFVEWTPP
KAKIDQIVLRYGLVGGEGPRTTFRLQPTLSQYSLQVLRPGSRYEVSVSGVRKGNESGSIS
TEFTTEIDAPKNLRLVSKTSTGLEIEWDNSEAEVESYQVVYSTLAGDLYDKVIVPRNEGT
TTKTSLTDLLPGTEYGIGISAMTGSNQSAPATMNARTGLDVPMDLTVVASTDNTITLVWG
VVQGPIDHYKVTYTSSSGTTAELNVPKDVTTTTLIDLEPGTEYTVTVAARRGRQQSTAAT
IDAFTGIRPVAHLYLSEVTSDSVLVAWSAPAPPADLFILSYSSADGTDTSKVTLDGSKMR
SQVQGLLPSTQYTVSLITIQGDVTSEPITASLTTGMDPPKEMTVADVTEDAVTISWIKPL
APFEYYKLSYQSARGRVDSVVIDSDVNNYTLSSLFPATEYEISLNAVRASQESKVVSTSV
FTAMDMPAELTALNITPQGTLLRWNPPVSSVDNYVLTLTYNQVTADTFLVEGNKQEHQLS
NLKPSTTYSVALYATKGALTSGTVITNIQTPMDSPLNLTASEVNHRSALISWQPPIAEID
NYMLTYRSTDGSRKELILDAEDTWIRLEGLAETAEYTVNLQAARGLDTSAVVSTTFTTGS
RLFATPQNCAQHLLNGEALSGVYTIYINRDASQGVQVYCDMTTDEGGWIVFQRRQNGLTD
FSRKWSDYRVGFGNLEDEFWLGLDNIQRIASQGRYELRIDMKDGQESVYANYDKFSIGDA
KNHYKLRLGEYNGTAGESLSYHQGRAFSNKDRDKDIAVTNCASSYKGAWWYQNCHRGNLN
GKYGEVQTQPEGINWYHWKGHEFSIPSVEMKMRPFNFRSISSKRRRSAP
Download sequence
Identical sequences G3PKN2
ENSGACP00000018162 ENSGACP00000018162 69293.ENSGACP00000018162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]