SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018462 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018462
Domain Number 1 Region: 18-255
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.05e-55
Family Ankyrin repeat 0.0000798
Further Details:      
 
Domain Number 2 Region: 269-313
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000249
Family SOCS box-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018462   Gene: ENSGACG00000013982   Transcript: ENSGACT00000018498
Sequence length 318
Comment pep:novel group:BROADS1:groupII:220883:226103:1 gene:ENSGACG00000013982 transcript:ENSGACT00000018498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNHHCRRNPELHEELQIQAAVAAGDVCTVRRMLEQGYSPKIRDANGWTLLHFSAAKGKE
RCVRVFLEHGADPTVKDFIGGFTALHYAAMHGRARIARLMLELEFRSDIINAKSNDGWTP
LHVAAHYGRDSFVRLLLEFRAEVDPLSDKGTTPLQLAIIRERSSCVRILLDHSANIDIQN
GFLLRYAVIKGNHTYCRMFLQRGADTNLGRLEDGQTPLHLSALRDDVLCAQMLYTYGGDA
NTRNYEGQTPVAVSVSMSGISRPCLDFLQEATRQPRTLQDLCRIKIRHCIGLHSLKLLED
LPIAKVMKDYLKHKFDSV
Download sequence
Identical sequences G3PLI1
ENSGACP00000018462 ENSGACP00000018462 69293.ENSGACP00000018462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]