SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018678 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018678
Domain Number 1 Region: 3-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-46
Family SPRY domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018678   Gene: ENSGACG00000014151   Transcript: ENSGACT00000018716
Sequence length 171
Comment pep:novel group:BROADS1:groupII:570409:570951:-1 gene:ENSGACG00000014151 transcript:ENSGACT00000018716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSCELTIDTNTVNTQLKLSDNNRKVTRVWKEDQSYPDHPDRFDYWPQLLCRTGLTGRCYW
EVEWRGDVYVSVSYRGIKRKGGRGECVFGWNDQSWCLRCSDKGYYVHHNKTDTAGRVAVY
VDCPAGSLSFYRVSSDTLIHIHTFSTTFTETLYPGFGFGLWSCSGSSVSLC
Download sequence
Identical sequences G3PM47
69293.ENSGACP00000018678 ENSGACP00000018678 ENSGACP00000018678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]