SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018774 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018774
Domain Number 1 Region: 69-125
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000562
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 2 Region: 185-234
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000575
Family TSP-1 type 1 repeat 0.00052
Further Details:      
 
Domain Number 3 Region: 131-179
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000209
Family TSP-1 type 1 repeat 0.0007
Further Details:      
 
Domain Number 4 Region: 23-66
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000196
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000018774
Domain Number - Region: 609-782
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00256
Family Rhodopsin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018774   Gene: ENSGACG00000014218   Transcript: ENSGACT00000018812
Sequence length 1254
Comment pep:novel group:BROADS1:groupXX:19410236:19462997:1 gene:ENSGACG00000014218 transcript:ENSGACT00000018812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTSLIYPEPVALTSPGNSASGEEWSAWSVCSATCGEGWQSRTRFCVSSSYSTQCSGPLRE
QRPCNNSAVCPVHGAWDEWSPWSLCSSTCGRGFRARTRTCAPPQFGGDACDGPAQQTKFC
NIAVCPGKELDGVWNEWSGWSSCSASCSNGTTQRTRECNGPSYGGSECRGEWLETVDCFL
GECPVEGKWQPWSLWSGCSKTCGGGSQQRNRICYGPFFGGQACPGEREEVRSCNEKRCPE
PHEICGEDNFSNVVWKMTPAGDTAAVRCPPNAVGLILRRCTLDEEGLAYWENPTYMKCIS
NDYRSIQTSTREHLSKAQRGLVGDGVSDVMNKLKVTSSDGTSYSGDLLAIVDVLKNMTEI
FRRAYYSPSSADMRNFVQSVSNLLMEENRERWEEAQLLGPNIKELFRLLEDFVDVIGLRM
KDFQDMYEVTDNLVLSVHKRPVVGHADISFPMKGWRGMVDWARSSEDRVTIPKNILSTGK
PGKPSSIVFLQKTKLLSNHTSKLELNMSTTILRSNHLPVIAKPHPNKAFVLHEVLHYWLY
NPHANQSCCLSDAQTFCFSRAAPLCWDLGWQGLQTGLVDSFRTKCAVLTDCPPFAILAAA
QPGERNMDKTQLPSVTLIVGCGVSSLTLLLLIIIYVSVWRYIRSERSVILINFCLSIISS
NALILIGQTQTRNKVLCTLIAAFLHFFFLSSFCWVLTEAWQSYMAVTGRLRNRIIRKRFL
CLGWGLPALVVAISVGFTKAKGYGTPSYCWLSLEGGLLYAFVGPAAAVVLVNMVIGILVF
NKLVSKDGITDMKLKERAGASLWSSCVVLPLLALTWMSAVLAITDRRSALFQILFAVFDS
LEGFVIVMVHCILRREVQEAVKCRVVDRQEDANGDSGGSFQNGHAQLMTDFEKDVDIACR
SGELQVWCSPHMVQLCLSLPAGTMKRSSLQGEEKASSGTLTLQKGSNFNTMPASMAKVHL
QNVSDYTSHTLTLRREKGPAKGISTELPGAKSIYICDGELFKQLDGELPRGNGEGSSSEG
TGKCPGYVILPTNSTGTLKPAKAKEEPTAKYNIGIEQLPQTRLIHLANPANGEPAPGFGL
KSLPAEQISVSCSDRDSPAHNAHNMPRDSQGANSMCDGPDAANSGVMSKSETVSTLSMSS
LERRKSRYAELDFEKIMHTRKRHQDMFQDLNRKIHSADKDRESPPVDAKADKQQTPSKRA
WEGIRKTHSPPSWVRKDLETVAASPLELQTVEWEKTSATIPLVGQEIMDLQTEV
Download sequence
Identical sequences G3PME3
ENSGACP00000018774 ENSGACP00000018774 69293.ENSGACP00000018774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]