SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018936 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018936
Domain Number 1 Region: 234-436
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.77e-52
Family Reprolysin-like 0.00033
Further Details:      
 
Domain Number 2 Region: 527-583
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000981
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 3 Region: 1073-1123
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000759
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 4 Region: 859-925
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000667
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 5 Region: 928-986
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000112
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 6 Region: 993-1053
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000222
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000018936
Domain Number - Region: 816-864
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0235
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018936   Gene: ENSGACG00000014347   Transcript: ENSGACT00000018974
Sequence length 1166
Comment pep:novel group:BROADS1:groupII:3078754:3123209:-1 gene:ENSGACG00000014347 transcript:ENSGACT00000018974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSSDRHGLNHDYVFVTPVEVDSEGGYLTHDVTRRSSRSRRSLSSSLHYRLSAFGQDMHLD
LVPSPVVGPGFTVQTVGLDGIATVMDDVGFHDCLYQGFIRNASASSAAISTCSGLSGLIR
VSQEEYLIAPLPQHLAAQHSYSAPDGHHPHVVYKRSAEHIVHRRSGRSSSTGSSTPDNPE
RGKLHFCGRRKQYAPKPPAEDSFIMLDDFVVPEAEGAGRLKRSPINSNRVGGLNVETLVV
ADRKMLEEHGRDNVTTYVLTVMNMVSSLFKDGTIGTDINIVVVSLLLLEQDPLGLTINHH
ADQSLNSFCQWQSGLVGKGGKRHDHAVLLTGLDICSWKNEPCDTLGFAPISGMCSKYRSC
TINEDTGLGLAFTIAHESGHNFGMIHDGEGNPCRKTEGNIMSPTLAGNNGVFSWSTCSRQ
YLSRFLGTAQASCLVDEPKQIGQYKYPEQLPGQLYNADTQCKWQFGSKAKLCSLDFVKDI
CKSLWCHRTGHRCETKYMPAAEGTGCGPNMWCRRGQCVKYGEHGPRAVHGQWTAWSQWSD
CSRTCGGGVMYRERSCTSPRPQNNGKFCSGSSRLNQLCNSRPCPPKSVGFRAQQCAEYNS
KPFRGWYYKWKPYTKVDDEDICKLYCIAEDYDFFFAMSGKVKDGTSCSEHKGDICIDGVC
EAVGCDQILGSKASLDACGACKGDNSTCKFFKGQYTLQHRANEYYSMVSVPAGARSIRVY
EMEASPSYLAARSLKRKYYLTGDWTVDWPGKFHFGGTVFDYQRSFNKPESLYAAGPTNET
LVFEILLQGKNLGVVWEYTLPRAERKPDYSWGVVRSDCSAPCAGGRISTKAICLEDQKVQ
VNSTMCIPHTRPALGSHLCNTQPCPASFWASGDWGLCSRSCGGGQQTRTLRCLRKVTYQR
EEVAAHSLCPVISPAQIQPCHTQACPPEWSTGSWSQCSKTCGRGLRKRSAFCRSTDPGAK
AVVVPDSMCRQHHRPKTQETCVLRRCPKNERLQWVTAAWGECSRSCGSGIQKRELRCGER
DSQGGYVEFPVRRCRNIAKPLVDLQQGCNRGPCPELPRAVPGRTSSGAVTLGWYPSPWQQ
CSVSCGGGVQARSIQCLRQGRPAGGCLPHQRPVTSRACNTHFCPAAPPADEPCVDHFSWC
HLVPQHGVCNHKFYGQQCCKSCSSGR
Download sequence
Identical sequences G3PMV3
ENSGACP00000018936 69293.ENSGACP00000018936 ENSGACP00000018936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]