SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018969 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018969
Domain Number 1 Region: 643-702
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000126
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 2 Region: 509-565
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000127
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 3 Region: 13-61
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000109
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 4 Region: 356-418
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000301
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 5 Region: 418-471
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000196
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 6 Region: 584-640
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000196
Family TSP-1 type 1 repeat 0.0087
Further Details:      
 
Domain Number 7 Region: 286-338
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000549
Family TSP-1 type 1 repeat 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018969   Gene: ENSGACG00000014379   Transcript: ENSGACT00000019007
Sequence length 709
Comment pep:novel group:BROADS1:groupII:3339927:3362384:1 gene:ENSGACG00000014379 transcript:ENSGACT00000019007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QASRTTRSDEDRDIGWDAWGSWSECSRTCGGGASYSLRRCLNGGSCGGKNIRYRTCSNRA
CPAESGDFRAQQCSAHNDIKYQGVTYDWSPSPYDPSAPCALRCQAKGRSVSVELAPKVLD
GTRCRADAFDMCISGVCQEVGCDRQLGSGAREDNCGVCGGDGSTCRLVRGQALLHLTPEL
PMRTVVEVPLGSRLFRLHAKGPNTIVIEAVSLKGRVDETSLVSAGSFVIGNTSLDFQRGT
DRQTLRTHGPLNADFVIKAAYTSGKDTVVQFLFYQPISHSERDGLLPCSATCGGGYQLNS
AECTDIRSNQTLPEHHCNSYPENTKPTPKLKECNMDPCPESDGFKEVLPYDHFQPLPRWE
QGPWTQCSASCGQGGGWQVRSMLCMEEDMQGRFSQVDEWKCTHSPRPVTQQICNTFACPQ
WVAMEWSQQCTVTCGHGLRYRVVLCIDHRGQHVGGCGASLKPHVKEDCLVPVACHKPRDS
VPVEAKVPWLKQPHQVEEQRSATEDPTFVPGPWSACSTTCGPGRQTREVKCQVLLSFTKT
EVDLPEEECGEERPRLLRPCNQGPCTKVPGLSVGLNMQAKELYSWDDRGFTVCSATCAAG
KQTAVVRCVSREQGEDVDDSLCDSSSKPPVIVRICSPEPCPPRWEATAWTSCSASCGVGI
QTRSVFCMRLMSVDQQDIVTVSEDECREFKPAILQPCNQVDCPPAWETE
Download sequence
Identical sequences G3PMY6
69293.ENSGACP00000018969 ENSGACP00000018969 ENSGACP00000018969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]