SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018971 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018971
Domain Number 1 Region: 221-300
Classification Level Classification E-value
Superfamily Immunoglobulin 4.94e-20
Family I set domains 0.0079
Further Details:      
 
Domain Number 2 Region: 326-404
Classification Level Classification E-value
Superfamily Immunoglobulin 7.23e-18
Family I set domains 0.0092
Further Details:      
 
Domain Number 3 Region: 497-561
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000068
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 4 Region: 622-676
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000196
Family TSP-1 type 1 repeat 0.0059
Further Details:      
 
Domain Number 5 Region: 445-502
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000196
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number 6 Region: 1-49
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000214
Family I set domains 0.064
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000018971
Domain Number - Region: 561-618
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00034
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018971   Gene: ENSGACG00000014385   Transcript: ENSGACT00000019009
Sequence length 712
Comment pep:novel group:BROADS1:groupII:3364278:3373362:1 gene:ENSGACG00000014385 transcript:ENSGACT00000019009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDGRPPPTSKHLGITKFGSLKIQVLSAEDIGVYTCVAGPASDIFTLQLLGGDSKSTGRLT
TASPPKWDQALPSCHRHHAGVSQLTGPGVSVSLLPPGGQEARLQPQVEERLINITLKADG
GEIQQEQASQLISSLLTHMSAAQLWTTSTADGGQAEDLGRKLHVLFVSVCLPDRRPNWSE
RSSLETHVKGAAIVRQPLTHPLAFQETVNISIGQSALLTNATRSLTIRCPAGGVPPPKVS
WTKDGAPLLPADRVSWDISGGLHILQPRVSDRGQYKCTATNTLGSDSETSQLLVAEPPAI
AVSWRNVSDLGAVLGQSLRSTVGGRVSVRPGANLTLDCPVTGFPPPTVTWNKKNGPFGTA
AVSLPSGSLWIRNVSLHHRGIYTCTAANAIGKSAASTDLQVYERATEGAAAAPPDLRAVR
VLQRWTFTLKVSSKSICIYILTTETSWRLGGWTTCSATCGNRGSGLRRVDCVNQEGKTVQ
PSMCRHVPKPIASPVGCNRQDCPPRWLVSEWSECSASCGGGWKRRQVSCQQLDARGAVRT
AASCERKSRPLDAEPCTASVCPVWVTSPWGKCSGRCLGRTSTIQKRSVLCQHVNGSSYTD
CDLRDRPPSVRNCSSDRCDVEWRPGAWRPCTVVCGSGFQSRRVDCVQRGSGRTLAEQNCA
WLQQPPTWQHCNTTSCGSECKDTTQYCSVVKRLKLCYLEMYKQRCCGSCSQH
Download sequence
Identical sequences G3PMY8
ENSGACP00000018971 ENSGACP00000018971 69293.ENSGACP00000018971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]