SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019109 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019109
Domain Number 1 Region: 212-414
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.57e-46
Family Reprolysin-like 0.0016
Further Details:      
 
Domain Number 2 Region: 507-557
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000196
Family TSP-1 type 1 repeat 0.0007
Further Details:      
 
Domain Number 3 Region: 925-972
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000458
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 4 Region: 802-861
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000131
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 
Domain Number 5 Region: 856-923
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000392
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019109   Gene: ENSGACG00000014484   Transcript: ENSGACT00000019147
Sequence length 1035
Comment pep:novel group:BROADS1:groupXIII:19078562:19133415:-1 gene:ENSGACG00000014484 transcript:ENSGACT00000019147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LITPFSTDSHGRYLSHLLSAAHKQRTKREAPPPGGAEQELFFNISAFGEEFHLRLRPNNR
LVAPGAVVEWHDADDGGEQGGNQTERNPHRELLKTDCTFIGDITDVPGASVAINNCDGLA
GMIRTDADEYFIEPLERGTQELEHQGRVHVVYRRSALLQPPADPPGDDDDLPPGYPMASE
DLRSVAFAAGAITERFNMQQDNRDKHAGEDDYNIEILLGVDDSVVRFHGKEHVQNYLLTL
MNIVNEIYHDESLGVHINVVLVRMIMLGYAKSISLIERGNPSRSLENVCRWAFVQQKSDS
EHAEHHDHAIFLTRQGFGPTGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVL
GMEHDGQGNRCGDETAMGSVMAPLVQAAFHRYHWSMCSGRELKRYISTYDCLLDDPFKHD
WPQLPELPGINYSMDEQCRFDFGVGYKICTSFRTFDPCKQLWCSHPDNPYFCKTKKGPPL
DGTECNPGKWCYKGHCMWKNPNQVKQDGAWGSWSKYGSCSRSCGTGVRFRTRQCSSPPPS
NGGQDCPGLNYEAALCNADDCPKHYEDFRAQQCQLRNSHFEFQNAKHHWLPYEHPDASKR
CHLYCQSKESGDVAYMKQLVHDGTRCSYKDAYSICARGECLKVGCDREIGSSKAEDRCGV
CGGDNSHCRTVKGSFTRAPKKPVGEGSLKMFLIPPGARRVIVQEHEASPHILAIKNQATG
HYILNGRGEEAASRSFIDLGVEWNYILEDQVEMLHTDGPLHDPVLVLVIIPKDNETRSTL
MYKYIIHEDSVPVNNNNVIQEDTYEWALKSWSPCSKPCAGGFQYTKYGCRKKGDTKMVHR
GYCDAGKKPKPIRRMCNLQDCTQPQWSSDDWEHCTKTCGSLGFQIRTVRCVQCLSDGTNR
SVHSKYCSGEKPESRRPCGRVSCPAQWRTGAWSECSVTCGEGMERRLVTCRIGDQCNGDK
PETVRFCRPAACHDILPFSSQQQYNVAVIRFQPAPSSPRSDEPCSGDKSIFCQMEVLARY
CSIPGYSKLCCDSCS
Download sequence
Identical sequences G3PNC6
69293.ENSGACP00000019109 ENSGACP00000019109 ENSGACP00000019109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]