SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019284 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019284
Domain Number 1 Region: 803-864
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000523
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 2 Region: 746-808
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000654
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 3 Region: 580-646
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000746
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 4 Region: 2-30
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000523
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 5 Region: 648-698
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000863
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 6 Region: 524-583
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000589
Family TSP-1 type 1 repeat 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019284   Gene: ENSGACG00000014610   Transcript: ENSGACT00000019322
Sequence length 908
Comment pep:novel group:BROADS1:groupIII:5172319:5186077:1 gene:ENSGACG00000014610 transcript:ENSGACT00000019322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WWGEWSSWSSCSRSCGGGVRSQERHCLIQSLWQLHRGPCSNFSLLMSFVSYGCCEKVIIP
PKNQQIGEQLSVMLNVRVRNGPTFKWRPMNPALSNHDNSLACDLQCTTISGERQLLVPAH
DGTFCHDAKYLGVCIEGICQPVGCDGQLYGSKAVDRCGVCGGNGTSCQRVSGSYRKALTQ
LGYVFITNIPAGASDIQIIERHKTENILALSDEAGHFFFNGNTVFENPQNFHVAGTVIKY
RRPSNIFSDGLEYITAQGPTLQGLNAMVDMKYYNLNGKLPHITYEYTIPRTSHDITAAED
VAGPSQPRLNLTYNEVNEGVGGDHLRATNGSVTSVHHYNSQLGAGDQSDVQLQDKKEEEV
IWAIRTPSPPPPAGVLVYRPPDVTTHVFGLNDVERGPPVPAGYRESHMHLSSFLTPGLLD
PFICLCPFTGSPSVHSAGGAPYLLLEDLHYNDTHSVDGPPTDPHSPAESHSLTSDTDPQL
EKLTVTDTHTAIVLQLQQVPAVQAANTESNDFDVGLDPDISLADMYRWKVSAYAPCSSTC
TTAGITTSYALCVRYDGTEVDDSYCDSLTRPEPTHEFCTGKECPPRWETSGWSECSRTCA
EGVQYRTVRCWKMLSPGLDSSVYDSLCLSHDLHKPANRKVCLGQSCGPQWEVSEWSECSA
RCGSRGVRTREVRCSLEMRLCKKSSQPIEGQECEGPPCHRRWTASTWCTPMVGTRVRRAV
YSPVTGPCRQCDLSLRPLAIYPCGDRDCAPHWVEQEWQQCNATCGRGVRHRQVVCVGLEG
GVFKEFPGSSCTHTNPPESSSSCFQRPCSKWFTTSWSQCSKTCGSGVQVREVKCYQGEEL
VTRGHSCISALRPEARQSCEIQSCPTEAPEDSCQDKPTANCALVLKVKLCSHWYYRKACC
QSCRAPRR
Download sequence
Identical sequences G3PNV1
ENSGACP00000019284 ENSGACP00000019284 69293.ENSGACP00000019284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]