SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019291 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019291
Domain Number 1 Region: 665-722
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000575
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 2 Region: 723-779
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000824
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 3 Region: 841-898
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000111
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 4 Region: 52-84
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000183
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 5 Region: 901-953
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000746
Family TSP-1 type 1 repeat 0.0076
Further Details:      
 
Domain Number 6 Region: 606-662
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000196
Family TSP-1 type 1 repeat 0.0087
Further Details:      
 
Domain Number 7 Region: 783-836
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000458
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019291   Gene: ENSGACG00000014615   Transcript: ENSGACT00000019329
Sequence length 1004
Comment pep:novel group:BROADS1:groupII:4167787:4192901:-1 gene:ENSGACG00000014615 transcript:ENSGACT00000019329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSSSLCVFLCRASVLWLLLSDLLDCQHATHQMKVPGRAEPPQEFRAEQGDIQGSWGAWGP
WTTCSRTCGRGVQEQSRACLPVHTPSLYPARRGGVPPQQPGYVISALRPTVPLHRDLGRS
SNSSRHGDPRETRPGERRYRMILHKRRRVTQINAGRYGYGRAPHVAPLQTDKGQSPRTPR
PQRQRRTVAADAHRHAARGHAARGHAARGHRSNNLEPANPAHHRSRPRAHQPKHNQVWAP
LYQPGSANQPQVHQEPQSGRQTPGPQQHQERPYEPLPSSFCTGEHAHYRICNSNACPPSS
RHIRAVQCSSYDSRPFMGRLYQWEPFNEVPLDQHCGLNCRAVGFRFYVLQSETVMDGTPC
GQNDTSLCVVGKCLGLGCDDYLGSGKVMDECGVCGGSNTTCRLISGVFKHSWTKVGYHKI
VEIPEGATKINVTEMVKSRNYLALRSRSGRFIINGNWAIDRPGEYEGGGAMFTYRRPNEI
RSTAGESFVGEGPTNEILDVYMIFQQPNPGVHYEYLLPSEQPVVPQQPNHGAEGRWHPLL
LPLLNTFYTYNQPSRHSLSWNQAGYDHHSNTQQERFHPAGGGREPPRLPDNHVPAAQPAT
RGREYNWRPGGSTECSASCGKGFRHSIFHCVSRLNQGQVSDALCDRSSRPTPQEEACNLE
PCPAFWDIGEWSECSKTCGLGMQHRQVLCRQIYANRTLNVHTSHCRHLERPEISSTCQMK
ICSEWQTRSEWTACSVPCGLGQRSREVRCVSNVGDFVPDDECNMNLRPVDVENCDMGTCA
KSWFYTEWSSRCSADCGMGARTRGVLCLTNQVSGLPLEGCGGERPADAQVCNNGLCENRI
EWFTGPWSQCSAECGAGSQQRSVVCLMKSDGGFAVMPPYECSSLDRPLGQQSCKLKACGA
KWYHTDWSACSKACERGFRVREVRCLSGDAQPSEDCDERRRPAGREDCNPEPCLPSIDEN
CRDKYFNCNVVVQARLCVYDYYKTTCCSSCSRGAHRQSVRHGRR
Download sequence
Identical sequences G3PNV8
ENSGACP00000019291 ENSGACP00000019291 69293.ENSGACP00000019291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]