SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019410 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019410
Domain Number 1 Region: 846-901
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 2 Region: 611-679
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000235
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 3 Region: 734-788
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000115
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 
Domain Number 4 Region: 50-107
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000419
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000019410
Domain Number - Region: 789-848
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00017
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number - Region: 558-616
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00157
Family TSP-1 type 1 repeat 0.013
Further Details:      
 
Domain Number - Region: 681-731
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00196
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019410   Gene: ENSGACG00000014701   Transcript: ENSGACT00000019448
Sequence length 948
Comment pep:novel group:BROADS1:groupXIII:19782374:19792011:-1 gene:ENSGACG00000014701 transcript:ENSGACT00000019448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDGRLRCNGKQQHLYTTEGTINATNTMNHRFQEDGVASNSLEEELEVTTYWWGEWAKWTA
CTRACGGGVMSQERHCLKQRKKVVAGKDNMTCTGTAKKYHLCNTEECPATGRSFREEQCW
SFNSQLYNGRNYQWKPLYPDDYVHISSNPCDLHCTTTDGQRQLMETARDGTSCKYSSYRG
VCVAGECQPIGCDGVLFSSNALDKCGVCQGDGSSCSRVTGNFRRVATSPGYSLITQIPEG
SWDIQIIERKKSADVLAVTTAGNFFLRSYRVDSPRLTQRRVSVRAMTCTRRIRHRRQNLH
RRTRPDPTSPPVAQVWNQNGRTPYITYEYTVLRDSLPPVPPPPAYTGSDTSAGEVSVEVG
GPPHPNGSAYDQAAPESRAEGGGADGQKGQETNEVYEGTAAIDCDQDPNFTGEEEQRSAL
FIPQTHKADQQRMKHSEFRGFDSPNLIWRVLLDGRIGPDELLVNISTNQLLTEGEGLFSS
EAGPEAGREADTGVLKRDGPLGVNDTLEFTLGRKRNESGDTSFQNKTVQSGGRTSGRSNR
TSLAQTNKKNLKLSAADMYRWKLSSQEPCSMTCSIGSVSKSFVTCIRYDGIEVHDMYCDA
LTRPEPVHDFCIGRECPPRWEASSWSECSRTCGEGFQFRQVRCWKMISPGLDSSVYSDLC
ATADLERPVERRPCKSPACGPQWEVAEWTECPAKCGRKAQVTRDVRCSEDARPCDPMTRP
PNAKNCTGPPCERQWTVSEWGPCSGLCGQGKTVRHVYCKAPEGRVVPENQCSAEDKPLAI
HPCGERDCAPHWLSQDWERCNTTCGRGVKRKLVLGVGISGGTFQTFAEEACGGSEKPEEE
TPASKRPCFKWYSTPWSRCTKTCGVGVRMRDVKCYQGTELVRGCDPLTRPVAKQTCTLQS
CPTEPPDESCQDRPSTNCLLALKVNLCSHWYYSKACCHSCRALRPPTS
Download sequence
Identical sequences G3PP77
ENSGACP00000019410 69293.ENSGACP00000019410 ENSGACP00000019410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]