SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019453 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019453
Domain Number 1 Region: 390-500
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-24
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 207-330
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-16
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 
Domain Number 3 Region: 507-564
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000292
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 574-635
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000135
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 5 Region: 153-215
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000584
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 39-154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000144
Family Spermadhesin, CUB domain 0.0088
Further Details:      
 
Domain Number 7 Region: 329-393
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000347
Family Complement control module/SCR domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019453   Gene: ENSGACG00000014730   Transcript: ENSGACT00000019491
Sequence length 635
Comment pep:novel scaffold:BROADS1:scaffold_762:79:8452:-1 gene:ENSGACG00000014730 transcript:ENSGACT00000019491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KHTMRGLKSEDEQTQTLQTVKLCVSVCVTVCVNTDQGPLCCMVNFSDPEGYIDSSDAPPL
PDGAVVHCTYTVTVYTGYGVELQVKSVNLSDGEQLSIRSADQRGALLVLANHTLLVEGQV
IRSPTNTLSVYYRSAPEASTGVFQLHYQIFRLSCSLPKRPHFGEVSVLDLLPGGTARFHC
HMGYHLQGEPRLTCLNASLPVWSGKVPACRALCGGTVKNATVGRVLSPSPPHGPNATQDR
SCSWSLEAPKDQRLHLHLERLALGLSERLVLWSGLDAGSVVLFDSGRGGHIPFEGVISEG
PAVRIQFISDRPDHNTGFNIRYEAFERGHCYEPYLQNGNFTTSDPLYGVGAVIQFSCDPG
HALEQGPPVIECVSARDPYWNDTEPLCKAQCGGDLGGPGGVILSPNWPEWYGEGEDCSWT
IHVGEDKRVLLDVQLLNISDSDMLTVTDGDEVTARILGRYVGGAGPFKLSSTTPDLTVTF
HSDPAGLVFGKGEGFIINYLEVSRNDSCPDLPEIQNGWKTTSHIALVRGAQITYQCDPGY
DLVGRETLTCELELSWSSQPPFCEKSQSPLSRVMYCSDPGHVEHSTRSLSDPKLLVGTTI
QYSCNPGFVLQGGATVTCYGREPGTPVWTSRLPHC
Download sequence
Identical sequences G3PPC0
69293.ENSGACP00000019453 ENSGACP00000019453 ENSGACP00000019453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]