SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019514 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019514
Domain Number 1 Region: 210-262
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000235
Family TSP-1 type 1 repeat 0.0004
Further Details:      
 
Domain Number 2 Region: 69-116
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000017
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 3 Region: 145-204
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000102
Family TSP-1 type 1 repeat 0.00099
Further Details:      
 
Domain Number 4 Region: 266-328
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000112
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 5 Region: 336-368
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000114
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019514   Gene: ENSGACG00000014780   Transcript: ENSGACT00000019552
Sequence length 415
Comment pep:novel group:BROADS1:groupXI:15888751:15891806:-1 gene:ENSGACG00000014780 transcript:ENSGACT00000019552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVLVFGTLATKQQTFLSVAIQGVRCFARFYLSLGQCDEELGEVDEEDCCQNPQYGYQTTD
GVCRSCGSPVWSPWSPWSQCNVPCGEGVMQRNRKCFGIEASECEKPKEKVEMIPCNGTCC
QSPCPGRPDTPGHALIPSIPCVPVSVAGVWSSWSSWSQCSSSCIPEDRAPIRYRRRTCSN
PAPSTDPPGMGCHGDDNENQNCNNLPHCPVDGGWGSWSPFSSCPVTCGVGLQESFKRCDN
PAPKHGGWPCPGEGRRTRICLTNTHCPVDGVWSDWSPWGKCTSPFPNRVIRCSKTGGGSQ
SRERRCLHQAHNGSICDGDGLTDTRVCYDVSACHLKGTWGEWDSWTLCSPPCGDGSRRFR
RRLCNLDYSDYSETTIGLKKEPANFSGRPNEDCGPLPDGEKRTQFQNCVGAPACP
Download sequence
Identical sequences G3PPI0
ENSGACP00000019514 ENSGACP00000019514 69293.ENSGACP00000019514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]