SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019863 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019863
Domain Number 1 Region: 7-298
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.79e-80
Family Protein kinases, catalytic subunit 0.00000576
Further Details:      
 
Domain Number 2 Region: 678-865
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.44e-47
Family Nucleotide and nucleoside kinases 0.0000000839
Further Details:      
 
Domain Number 3 Region: 548-668
Classification Level Classification E-value
Superfamily SH3-domain 8.66e-32
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 4 Region: 341-389
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000000812
Family L27 domain 0.00018
Further Details:      
 
Domain Number 5 Region: 470-515
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000762
Family PDZ domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019863   Gene: ENSGACG00000015058   Transcript: ENSGACT00000019901
Sequence length 869
Comment pep:novel group:BROADS1:groupI:24949671:24977691:-1 gene:ENSGACG00000015058 transcript:ENSGACT00000019901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADDDVLFEDVYELCEVIGKGPFSVVRRCINRDTGQQFAVKIVDVASFTSSPGLSTEDLK
REASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASH
YMRQILEALRYCHDNNVIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRV
GTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEAIIKGKYKMNPR
QWAHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNA
RRKLKGAVLAAVSSHKFNSYYGDPPEELHDFSEDPTSSGLLAAERAVSQVLDSLEEIHAL
TDCSEKDMDFLHSVFQDQHLHTPARLIPKAASSVAASQQNTILYDPGSLGPVRPHVLSIS
VIFIRDAGSGCSCWTPGNLNDNGMCWAALESAPKSLICCLFIKSLFLPASGTLHVGDEIR
EINGISVANQTVEQLQKMLREMRGSITFKIVPSYRSQSGSCDKESPDASRQSPANGHASV
TSSILDLPATIQPKGRQIYVRAQFEYDPAKDELIPRKEAGIRFQVGDIIQIISKDDHNWW
QGKLENTKNATAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHN
AVFDQLDLVTYEEVVRVPSFKRRTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRP
PKKDEENGKNYYFVSHDQMMQDISNNDYLEYGSHEDAMYGTRLETIRQIHTQGMISILDV
EPQALKILRTADFAPYVVFIAAPTVTPGMTEDDSLQRLQKESEMLQGTYAHYFDQTIINN
EIDDTIRLLEEAVDLVSTTSQWVPVSWVY
Download sequence
Identical sequences G3PQH8
ENSGACP00000019863 ENSGACP00000019863 69293.ENSGACP00000019863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]