SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020186 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020186
Domain Number 1 Region: 241-265,292-451
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-36
Family Laminin G-like module 0.0000146
Further Details:      
 
Domain Number 2 Region: 466-671
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.55e-25
Family Laminin G-like module 0.0000488
Further Details:      
 
Domain Number 3 Region: 42-94
Classification Level Classification E-value
Superfamily GLA-domain 4.88e-20
Family GLA-domain 0.00054
Further Details:      
 
Domain Number 4 Region: 111-241
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000138
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020186   Gene: ENSGACG00000015305   Transcript: ENSGACT00000020225
Sequence length 678
Comment pep:novel group:BROADS1:groupII:7709432:7715812:1 gene:ENSGACG00000015305 transcript:ENSGACT00000020225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRRKRALGESLAGLVCLVTLVDAYRFLSQSTASQFLSRQRRANSLFEESKKGNLERECI
EELCNKEEAREIFENNPETEYFYPKYVACLGSHRVGINNPNSHAIPSDLRTCVTEISDQC
TPPPCYREGSNRCVDGQASFTCECKPGWKGRRCEDDIDECSDPEYPAGCNQKCYNLPGSF
HCMCEEGYFINDKVNCVDIDECLMYPSICKDMAKCVNTLGMYECQCPLGFKYDFPSKTCN
DIDECKLNVCDGKCINTAGSYSCHCDGRQHLYLGADERYCKMIPVCVDLYDYRHPEMLYL
GEQFAGLPVIFLRYRLPENTKFAAEFDFRTFDPEGVVLYAESSQDSWFMLGLRGGRIEVQ
FKNQHTFKVTSGGKAINDGQWHVISVDELEGSISVKISMEAVMSINSPDSLFTSVNGKLE
TKVYLAGLPNRTDNVIKPINPRLDGCIRGWNLMNQGASGVKEVIQEKKSKHCFVFVERGS
FFAGEGLAHFNIDYICVYNVGDSGSWNIDIKMNIRPSSSTGVLFALIHNNTVPLSVAVVT
RSLTSTLQNLQVFLDGVSVATLDSVMLCYPDRVTVQLNVTPTEIQISANSSTVAFVKSDA
LQEALKQLNSTMQNPISTYIGGIPVDVPLPATPVTAFYHGCMDIAINGQQLDFDDALSKH
NSIRSHSCPPVSPPESHP
Download sequence
Identical sequences G3PRF1
69293.ENSGACP00000020186 ENSGACP00000020186 ENSGACP00000020186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]