SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020335 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020335
Domain Number 1 Region: 834-947
Classification Level Classification E-value
Superfamily SEA domain 5.1e-17
Family SEA domain 0.0092
Further Details:      
 
Domain Number 2 Region: 169-247
Classification Level Classification E-value
Superfamily SEA domain 0.00000000536
Family SEA domain 0.008
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000020335
Domain Number - Region: 996-1039
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0184
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020335   Gene: ENSGACG00000015420   Transcript: ENSGACT00000020374
Sequence length 1178
Comment pep:novel group:BROADS1:groupI:27380885:27398176:-1 gene:ENSGACG00000015420 transcript:ENSGACT00000020374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKALIRRRRDILFPSGVKLCSQETLQQAVNNHLKYFQLRVCQEMVWEAYKVFWDRLPEQV
EYQNWVGRCIHESVSAREIGHFFSQSEEHVRLVRIKYSLTLILKLTECVTILCFHPSESF
HGDADEQVRMLTPELNSAAYPCLPSTDGAPADLNRPIGNEIEAEAWPPRPLKEHIVELSL
RLRGETYNDALRDPSSFQYQQLAKSFTRRIEEVFERLPGFKTVFVVEFRPQKDLDRGLVV
LVHYVITLEVNSDSGVTNDTLDFISLQNNLVEKNYPGAAEQPTVVYTITDFRNYITEALH
KDNFMSNSSLEMPLDALQGENGTKNRFINAPEEEAEHKQRPFSSISLNTSDRTTSSLQRS
LLTLRTTSSTSPTLCSTKMSSSSTPSTRRRTLCRPSAFSDEILYEDGVSSLEALPPPDLE
NEEEEATENKDVASMEFQFTVASQLRKAPAFDGRIEETFLDQDLVTPHIRTDPRHSTTNE
APVFSPKRTFAFELLVEASGIHDDDFLTRPHTLMTPVTDSSELEPWTQKIHVFAGPTNWG
LKPPDMTEDVYTEASFDLMTKESPTFVKVHSEPSFDFFTKESLPFVEVHSEPVFDSTTEN
QAEFQIFTETYLLTETKEEDKVEILEEQDMGGTEPTIKTASEVGLRDKHLVVDKIMVVPL
TAAAPVLTSTLKSDYSGRIALSPEMDSPFTRVSDSAPDDEEPVPHERLNHDEEFLMSGPT
SGVRHYTSSHQGDIMSPGASAQDENTLTTSTNTSESESSIKPLHTTSSSLQEVDQNPPAA
EVQVFDHDISEVPGINVSFDLFQYAGEVAEGDSSGFFSGAQVSDPDAVALKTRPGHALTV
FFSLRVTNMAFSLDLFNRSSPEYKALEHQFLQLLVPHLQSNLNNFKNLEILNFRNGSIVV
NSRMRFGKPVPQGVTNVVYLILEDFANTAYQTMNLDIDKYSLDVESGDRADPCKFQACND
FSRCLVNRWSGEAECVCAAGYLSVDGLPCRSVCELQLDFCLNDGKCDIIAGKGAICRCRV
GENWWYRGEHCEEFVSELLVVGIAVASVAGFLAVAAAIIFFLGRTLRDQYDGGDTEDPLR
RGDCGPTLKQADKLNTAFEGEPVSARYYRRYDDRPRHSSSTGTGRPLDLNADELQQIYQN
AALTKEEVQERLRVLELCVRDQQFADFVRQTQVTLEEL
Download sequence
Identical sequences G3PRU9
ENSGACP00000020335 ENSGACP00000020335 69293.ENSGACP00000020335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]