SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020379 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020379
Domain Number 1 Region: 347-612
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.33e-84
Family Eukaryotic proteases 0.0000000539
Further Details:      
 
Domain Number 2 Region: 209-301
Classification Level Classification E-value
Superfamily Kringle-like 8.7e-28
Family Kringle modules 0.00027
Further Details:      
 
Domain Number 3 Region: 114-201
Classification Level Classification E-value
Superfamily Kringle-like 2.42e-27
Family Kringle modules 0.00024
Further Details:      
 
Domain Number 4 Region: 41-91
Classification Level Classification E-value
Superfamily GLA-domain 2.52e-20
Family GLA-domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020379   Gene: ENSGACG00000015448   Transcript: ENSGACT00000020418
Sequence length 618
Comment pep:novel group:BROADS1:groupI:27447117:27451940:1 gene:ENSGACG00000015448 transcript:ENSGACT00000020418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMEETKLKAAALLLFLIHICLADQVFLNSQLATQLLPRSRRANQMFEEIKPGNLERECVE
EICDHEEAREVFEQTEKTENFWTKYLVSDCKGTQMTRTQHNINIVRQCVEVLKISRSGVN
YEGNINITQSGRKCQPWSSSYPHPIFREFNASEPNSILLENFCRNPDSRPEGPWCFTKDP
AVPKETCRVPTCGQDFVPPTVAPEPTRTAACLLNYGVDYVGDLSVTLGGHTCLQWSSREA
KALSVDKDFIPEVGLPGNKCRNPDNDPEGPWCYVELSGNVTIDYCDLELCEDLVTEDVLT
TDTEGQERSVLKPARKTFFSPRTFGEGESVCGERPLFEKLKKKDRNEAELLESYRQERIV
GGDDAEVASAPWQVMLYKRSPQELLCGASLISDQWIVTAAHCILYPPWNKNFSASDILVR
LGKHNRAAFERGIEKIVAISEIIVHPKYNWKENLNRDVALLHLRRPVGFTDAIHPICLPN
RKVATALMTQGYKGRVTGWGNLKDTWNPSARNLPEVLQQIHLPIVDQDVCSSSTSVKVTD
NMFCAGYKPDDAKRGDACEGDSGGPFVMKYPADDRWYQMGIVSWGEGCDKDGKYGFYTHL
FRMNRWMRKIIEKTGKDD
Download sequence
Identical sequences G3PRZ3
69293.ENSGACP00000020379 ENSGACP00000020379 ENSGACP00000020379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]