SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020412 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020412
Domain Number 1 Region: 42-259
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-61
Family SPRY domain 0.0000000255
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000020412
Domain Number - Region: 248-285
Classification Level Classification E-value
Superfamily SOCS box-like 0.000418
Family SOCS box-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020412   Gene: ENSGACG00000015471   Transcript: ENSGACT00000020451
Sequence length 286
Comment pep:novel group:BROADS1:groupIII:8179290:8202138:-1 gene:ENSGACG00000015471 transcript:ENSGACT00000020451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKISGGIKSVDDRGESGGSPSYRPLAQRRQHPELRGPDFVKPPRLDLLLDMPCAGPEA
QLRHAWNPDDRSLNIFIKDDDKLTFHRHPVAQSTDCIRGRVGYTRGLHVWRIHWPSRQRG
THAVVGVATSQAALHSVGYTALVGSDCESWGWDLGRYRLYHNSKNRAHSSLPSYPCFLEP
QESLVLPDSLLVVLDMDEGTLSFMVNERYLGVAFRGLKGKKLHPVVSAVWGHCEVAMEYV
NGLDPEPLPLMDLCRRAARLALGRERLKEIRGLPLPQSLKDYLQYK
Download sequence
Identical sequences G3PS26
ENSGACP00000020412 ENSGACP00000020412 69293.ENSGACP00000020412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]