SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020413 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020413
Domain Number 1 Region: 162-432
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.06e-77
Family Eukaryotic proteases 0.0000812
Further Details:      
 
Domain Number 2 Region: 40-101
Classification Level Classification E-value
Superfamily GLA-domain 3.53e-23
Family GLA-domain 0.00042
Further Details:      
 
Domain Number 3 Region: 126-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000904
Family EGF-type module 0.0036
Further Details:      
 
Domain Number 4 Region: 92-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000325
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020413   Gene: ENSGACG00000015472   Transcript: ENSGACT00000020452
Sequence length 457
Comment pep:novel group:BROADS1:groupI:27514141:27518203:1 gene:ENSGACG00000015472 transcript:ENSGACT00000020452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLVLVLVLVLVLDLVSGVAAAVRVEKQEALGLLARRRRANSGFLEELKQGDLERECREEI
CDYEEAREVFEDDGRTKQFWLSYNRRDPCLENPCRNNGTCVYLETTYQCYCAEGFEGRFC
QTEVEDFLKCLYNNGQCEHYCDGSGERRRCSCADGFKLGEDGRRCVAQVEFPCGQLPETG
VNQTVGAQTRLVGGNQCPRGQCPWQVLVQFNGLSHCGGALIKPDWVVTAAHCIHGNLPQS
LVVVAGEHNLDLHEGTEQRLPVSMAIAHEGYVPATGDNDVALLRLTRPAALSGLALPVCL
PTRGLAERELLATRYHTVSGWGKRTSGGNKADAPSAPVSPVLRRMSVPILLNSQCSQKAQ
FNFTANMLCAGYLEGRQDSCRGDDGSPLVTLHGSTHFLTGVVGWGRGCSHPGYYGVYANV
AHFVDWAEGVMKDPPTISTANETAAHTDLEMLQHKVV
Download sequence
Identical sequences G3PS27
ENSGACP00000020413 69293.ENSGACP00000020413 ENSGACP00000020413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]