SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020501 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020501
Domain Number 1 Region: 1232-1388
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-40
Family C-type lectin domain 0.00000633
Further Details:      
 
Domain Number 2 Region: 149-255
Classification Level Classification E-value
Superfamily C-type lectin-like 6.41e-36
Family Link domain 0.0026
Further Details:      
 
Domain Number 3 Region: 259-355
Classification Level Classification E-value
Superfamily C-type lectin-like 1.47e-27
Family Link domain 0.0023
Further Details:      
 
Domain Number 4 Region: 33-147
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000144
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 
Domain Number 5 Region: 1388-1446
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000834
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 6 Region: 1186-1225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000229
Family EGF-type module 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020501   Gene: ENSGACG00000015542   Transcript: ENSGACT00000020540
Sequence length 1446
Comment pep:novel group:BROADS1:groupXIV:271907:288640:1 gene:ENSGACG00000015542 transcript:ENSGACT00000020540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMLHVLTHLIGLVCLSAARPQAASSASMTMQNNPPLTGSLGHHVTLPCQFSIPPISADTP
TPGSREELRIKWTKLKKDGEEVVLVTLGGAAKEGQRYAGRLSWQSPQPSGGDASLMLGGL
RASDAGVYRCEVIHGMEESRETVRLNVSGVVFHYRANASRYTMNLHAAMDACRSAGADIA
TPDHLAAAFEDGLDQCDAGWLADRSVRYPIRTPRPGCYGNLGNRPGVRTYGVRDASEEYD
VYCYVGKLRGEVFYPSSVNAKLTLQEARDKCERHGAVLASPGQLFAAWREGLNRCDYGWL
SDGSARYPVTQPRPQCGGGLLGVRTLYKYPNQTGYPDASDRHGLYCYRGELDPAQRPAEG
GTPPRNTVIKKPTLTEMASKKTNATPRYTTASATPTTMSEYALTDPLLPMAFPPLPTTRG
QPPQLDISQGGQDEGGANSGSGEGGSSDGRSSGAEAVTLVTPTPAWGETSTGSSRLLKTT
TGSGLGGETSRPPRLLALTTVAVAPGTHTPGLGVPGGAVEAGKQPVVVFKEEVSPETAST
FDLDQSSGKPPFHLIIVNVHNQNQSGEERMLDACYKSNMSHSEATSCQLKNDKQNCGAPS
RPPCYCSKTTDINQLFFSLTFLTWTERGLASRHMFPVTCFPLGPSLRRQRLGSRTAHVSP
ERFDLSARTFLFGGLLRLYMCTEGTERARYLFVFVCRQILTEPDVENDELFQQCRPSLSY
PAFVCVTSMDGLLSQDQEQGGPSAQGPQSLGIRIRITAGASVSRCPSKLISGLCLRHIFY
IYGFHVSHEALMKTHKLHCLRAAAGSERPSPQTTSDTRSSQEALSLNASFYSEKPVQPDQ
RSTSLRYYITDRVTSSSSPVTNDPKVIRESRLSLECEAVGGSSLLISSSLSLVSHILDIL
SQSASPTSPRGPARGSRTAGTPILWRSTRSTCPPPSASSTKNTSKTSIRIPLNQRRSTKY
LVNXHDGRDRNRWDRASEAAGVTTGLRSGDPEGSASGEDEASGQGRGFGTRPPGDDRATP
ICRPLLVYSTRRPPPDDPVTEVASGAEQLSEIIAATDITDVAAVTLRAPTTEVKKDPTPP
APAESMIPIDQRPSSAEESTTSSAHYISEPLYTFDHETRSVPQWALVPDPAATPLPNEQF
VDYDSQIAPPLVEVRPPTQPAGAVEVSTGLRDVCNAPACPSSDPLLCSSSFCLNGGSCYQ
RTSQNLCACAPGYTGPRCSAEVDECRSNPCLNGATCVDGVSSFTCLCLPSYSGELCGQDT
EVCGLGWEKFQSHCYKYVNHRRTWDAAERECRLHGAHLASVLSQEEQLYVNGLGSDYQWL
GLNDKMFERDFKWTDGNPMQYEHWRPNQPDSFFQSGEDCVVMIWHEGGQWNDVPCNYHLT
FTCKKGTVSCGPPPAVRDTRVFGALKPRYEINALLRYHCKRGFVQRHAPTIRCRADGQWD
APKVTC
Download sequence
Identical sequences G3PSB5
ENSGACP00000020501 69293.ENSGACP00000020501 ENSGACP00000020501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]