SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020668 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020668
Domain Number 1 Region: 829-937
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-24
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 2 Region: 308-428
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.92e-18
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 33-161
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.3e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 270-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000262
Family EGF-type module 0.02
Further Details:      
 
Domain Number 5 Region: 643-805
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000185
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number 6 Region: 160-307
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000173
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020668   Gene: ENSGACG00000015663   Transcript: ENSGACT00000020707
Sequence length 1013
Comment pep:novel group:BROADS1:groupII:10044350:10059665:-1 gene:ENSGACG00000015663 transcript:ENSGACT00000020707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAIWVARDFCLFLLLLNSRQSAALPNIRADPCEEGSDGCHIDAICQTTQGSYKCSCKAG
YKGDGKHCEDIDECDLEYNGGCVHECNNIPGNYRCTCYDGFNLAHDGHNCLDVDECKFNN
GGCQHTCVNTMGSYECRCKEGFFLSDNQHTCIHRSVEGLNCMNKEHGCTHICKETPKGGV
ACECRPGFELARNQRGCILTCNHGNGGCQHTCEDTENGPICRCHVRYNLQPDKRSCVERD
EATTESAEHNATFFTEVDKRVKRRLLMETCTSNNGGCDCTCKDTSTGVRCSCPVGFTLQP
DGKTCKDIDECEPHNGGCEHSCRNTIGSFECNCRKGFKLLTDERSCQDIDECFFERTCGH
TCVNSPGGFQCLCNKGYTMYGLAHCGDINECSVNNGGCEQGCENTVGGFDCVCRPGYKLH
WNKKDCIEAEGFPPAKPPSKPTLNCSKQEGGDRCSLTCQSQVRISSGTEDSYTVTCGMPL
PCLADAQRNDSGLRCLGIKTTATFKSGATKCNLKRSQEKLKESLNSPHSDSRFLFTENVQ
FSYVSLRCSSSGLRMRSRHGRKAGEEDVSSITAEFELDVNLEEVTADSCDLNCVRRRSEK
RLRKTIRTLRKSINREQFHLHFAGSDYELAKGLGKPAGLPGHCAAGQVLVGRKCVSCSVG
TYYDADQGRCVLCPSGTYQDEEAQMSCEVCPGPEGRDVSKVVGARNMSECEGQCPPGQYS
HDGFVPCLPCPLGAYQPEVGRTNCFPCGGNLVTKHSGAVTFQECETKVQCSPGHYYNTST
HRCIRCPVGTYQGEFGQNYCVSCPGNTTTDFDGSTYFMQCKNRQCGGELGDFTGFIESPN
YPGNYPANVECTWTINPPPKRRILIVVPEIFLPIEDECGDYLVMRKSSLSNSVTTYETCQ
TYERPIAFTSRSKRLWIQFRSNEGNSGKGFQVPYVTYDEDYQELIEDIVRDGRLYASENH
QEILKDKKLMRALFDVLAHPQNFFNYTAQESREMFPKSFIRFLRSKVLRFLRP
Download sequence
Identical sequences G3PST2
69293.ENSGACP00000020668 ENSGACP00000020668 ENSGACP00000020668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]